KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103731713
Entry
103731713         CDS       T03372                                 

Gene name
Mecom
Definition
(RefSeq) MDS1 and EVI1 complex locus protein EVI1
  KO
K04462  ecotropic virus integration site 1 protein
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04010  MAPK signaling pathway
ngi05200  Pathways in cancer
ngi05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103731713 (Mecom)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103731713 (Mecom)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    103731713 (Mecom)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ngi03000]
    103731713 (Mecom)
Transcription factors [BR:ngi03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    103731713 (Mecom)
SSDB
Motif
Pfam: zf-C2H2 zf-C2H2_4 zf-H2C2_2 zf-C2H2_6 zf-C2H2_jaz zf-H2C2_5 zf-met zf-BED zf-C2H2_11 zf-C2H2_8 Zn-ribbon_8 PyrI_C
Other DBs
NCBI-GeneID: 103731713
NCBI-ProteinID: XP_008828347
Position
Un
AA seq 1042 aa
MKSEDYPHETMAPDLHEERQCRCEDCDQLFESKAELADHQKFPCSTPHSAFSMVEEDFQQ
NLESESDLRETHGIQECKECDRVFPDLQSLEKHMLSHTEEREYKCDQCPKAFNWKSNLIR
HQMSHDSGKHYECENCAKVFTDPSNLQRHIRSQHVGARAHACPECGKTFATSSGLKQHKH
IHSSVKPFICEVCHKSYTQFSNLCRHKRMHADCRTQIKCKDCGQMFSTTSSLNKHRRFCE
GKNHFAAGGFFGQGISLPGTPAMDKTSMVNMNHANPGLADYFGTNRHPAGLTFPTAPGFS
FSFPGLFPSGLYHRPPLIPASSPVKGLSSTEQSNKSQSPLLTHPQILPATQDILKALSKH
PPVGDNKPVELLPERSSEERALEKISDQSESSDLDDVSTPSGSDLETTSGSDLESDLESD
KEKCKENGKMFKDKVSPLQNLASINNKKEYSNHSIFSPSLEEQTAVSGAVNDSIKAIASI
AEKYFGSTGLVGLQDKKVGALPYPSMFPLPFFPAFSQSMYPFPDRDLRSLPLKMEPQSPS
EVKKLQKGSSESPFDLTTKRKDEKPLTPVPSKPPATPATSQDQPLDLSMGSRSRASGTKL
TEPRKNHVFGEKKGSNMEGRVASDGSLQHARPTPFFMDPIYRVEKRKLTDPLEALKEKYL
RPSPGFLFHPQMSAIENMAEKLESFSALKPEASELLQSVPSMFNFRAPPNALPENLLRKG
KERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHVRNIHNKEKP
FKCHLCDRCFGQQTNLDRHLKKHENGNMSGTATSSPHSELESTGAILDDKEDAYFTEIRN
FIGNSNHGSQSPRNMDERMNGSHFKDEKALVTSQNSDLLDDEEAEDEVLLDEDDEDNDVP
GKPRKEPGTSNLDEGIPEDDYEEAGALEMSCKTSPVRYKEEDYTSGLSALDHIRHFTDSL
KVRKTEDAQYTEAELPSFSSSHVPEELKQPLHRKSKSQAYAMMLSLSDKDSLHSTSHSSS
NVWHSMARAAAESSAIQSISHV
NT seq 3129 nt   +upstreamnt  +downstreamnt
atgaagagcgaggactatccccatgagaccatggcgcctgacctccatgaagagcgacag
tgtcgctgtgaagactgtgaccagctctttgaatccaaggctgaactagcagaccaccag
aagtttccatgcagcacgcctcactcagcattctcaatggtggaagaggacttccaacaa
aaccttgagagtgagagtgatctacgagagacacacggcatccaggagtgtaaggagtgt
gaccgagtgttcccagatttgcaaagcttggagaaacacatgttgtcacatactgaggag
cgggagtacaagtgtgatcagtgtcccaaggcatttaactggaagtccaatttaattcgc
caccagatgtcacatgacagtggaaagcactatgaatgtgaaaattgtgccaaggttttc
acggaccctagcaaccttcagcggcacattcggtctcagcatgttggtgcccgggcccat
gcttgcccggagtgtggtaaaacatttgccacttcatcaggcctcaaacaacacaagcac
atccacagcagtgtgaagccctttatctgtgaggtctgccataaatcctatactcagttt
tcaaacctttgtcgtcataagcgcatgcatgctgattgcagaacccaaatcaagtgcaaa
gactgtggacaaatgttcagcactacgtcttccttaaataaacacaggaggttttgtgag
ggcaagaaccattttgcggcaggtggattttttggccaaggcatttcacttcctggaacc
ccagctatggataaaacgtccatggttaatatgaatcatgccaacccgggccttgctgac
tattttggcaccaataggcatcctgctggtcttacctttccaacagctcctggattttct
tttagcttccctggtctgtttccttcgggcttgtaccacaggcctcctttgatacctgct
agttctcctgttaaaggactatcaagtactgaacagtcaaacaaaagtcaaagtcccctc
ttgacacatcctcagatactgccagctacacaagatattttgaaggcactatctaaacac
ccacctgtaggggacaataagccagtggaactgctgcccgagaggtcctctgaagagagg
gcccttgagaaaatcagtgaccagtcagagagtagtgaccttgacgatgtcagtacacca
agtggcagtgatttggaaacaacctcgggctctgacctggaaagtgaccttgaaagtgat
aaagagaaatgtaaagaaaatggtaaaatgttcaaagacaaagtaagccctctgcagaat
ctggcttcaataaataataagaaagaatacagcaatcattccattttctcaccatcttta
gaggagcagactgcggtgtcgggagctgtgaatgattctataaaagctattgcttctatt
gctgaaaaatactttggttccacaggactggtggggctgcaagacaaaaaagttggagct
ttaccttacccttccatgtttcccctcccattttttccagcattctctcaatcaatgtac
ccatttcctgatagagacttgagatcgttacctttgaaaatggaaccccaatcaccaagt
gaagttaagaaactgcagaagggaagctctgagtccccctttgacctcaccactaagcga
aaggatgagaagcccctgactccagtcccctcgaagcctccagcaacacctgccacaagc
caggaccagcccttggatctaagcatgggtagtcgaagtagagccagtgggacaaagctg
accgagccgcggaagaaccatgtctttggggaaaagaaaggaagcaatatggagggcaga
gtggcttcggatgggtctttgcagcatgccagacccacgccctttttcatggatcccatt
tacagagtagagaaaagaaagctaactgacccacttgaggctttgaaagagaaatacttg
agaccttctccaggattcttgttccacccacaaatgtcagctattgaaaacatggcagag
aagttagaaagcttcagtgctttgaagcctgaggccagcgagcttttgcagtcggtgccc
tccatgttcaacttcagagcacctcccaacgccctgccggaaaacctgctgcggaagggg
aaagagcgttatacctgcagatactgtggcaagatttttccaaggtctgcgaacctaaca
cggcacttgaggacccacacaggagagcagccttacagatgcaaatactgtgatcgatca
ttcagcatatcctcaaacttgcagcgacatgttcgtaatatacacaataaagagaagcca
tttaagtgtcacttgtgtgacaggtgttttggtcaacaaaccaatctagacagacacctg
aagaaacatgagaatgggaatatgtctggtacagcaacatcatcgcctcattctgagcta
gaaagcacaggtgcaatcctggatgacaaagaagatgcttactttacagagatccgaaat
ttcattggaaacagcaaccatggtagccaatctcctaggaacatggatgagagaatgaat
ggcagtcactttaaagatgaaaaggctctggtgaccagccaaaattcagatttactggat
gatgaggaagcagaagacgaggtgttattagatgaggatgatgaagacaatgatgtgcca
ggaaaacccagaaaggagccagggacaagtaatttagatgaaggcattcctgaggacgac
tatgaagaagccggtgccttggagatgagttgtaagacatccccggtaaggtataaagag
gaagattacacatcgggactgtctgctctggatcacataaggcatttcacagatagcctc
aaagtgaggaaaacggaagatgctcagtacactgaagctgagctgccttcttttagctct
tcccatgtgccagaggaacttaaacagcccttacacagaaagtctaaatcgcaggcatat
gctatgatgttgtcactgtctgacaaggattccctccattccacatcccacagttcctcc
aatgtgtggcacagcatggcaagggctgcagcggaatccagcgccatccagtccataagc
catgtatga

DBGET integrated database retrieval system