KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103732023
Entry
103732023         CDS       T03372                                 

Gene name
Erap1
Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ngi01002]
    103732023 (Erap1)
Enzymes [BR:ngi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     103732023 (Erap1)
Peptidases and inhibitors [BR:ngi01002]
 Metallo peptidases
  Family M1
   103732023 (Erap1)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 103732023
NCBI-ProteinID: XP_008828765
Position
Un
AA seq 942 aa
MAPLPLKWPLANMPFFFSSLLTLLVVSPPSWCQNGAAPSPKASNGAPFPWNKMRLPKNVT
PIHYNLMIHANLSTLTFQGTTEIEIIASQPTSTIILHSHQLHISKATLQRRPGEILSEEP
LRVLEYPPHEQIALLAPEPLFAGRLYTVVIDYAGNLSENFHGFYKSTYKTKEGEVRILAS
TQFEPTAARMAFPCFDEPALKASFSINIRRESKHLAISNMPLVRSVTVAKGLMEDQFDVT
VKMSTYLVAFIVSDFKSVSKMTKSGIKVSVYAVPDKINQADYALDAAVTLLEFYEDYFSI
PYPLPKQDLAAIPDFQSGAMENWGLTTYRESALLFDAEKSSASSKLGITMTVSHELAHQW
FGNLVTMEWWNDLWLNEGFAKFMEFVSVSVTHPELKVEEYFFGKCFDAMEVDALNSSHPV
STPVENPAQIREMFDDVSYDKGACILNMLRDYLSADAFKSGIVKYLNKYSYRNTKNDDLW
DSMASICPTDGAQTVDGFCSRSQRSSSASHWHQEGVDVKTMMNTWTLQKGFPLITISMRG
RNVHMKQEHYMKGSDSALETGYLWHVPLTFITSKSNSVQRFLLKTKTDVLILPEAAEWIK
FNVGMNGYYIVHYEGDGWDSLTDLLKRAHTAVSSNDRASLINNAFQLVSIGRLSIEKALD
LILYLKNETEIMPVFQGLNELVPMYKLMEKRDMNEVETQFKTFLLRLLRGLIDKQTWTDE
GSISERMLRSQLLLLACVRKYQPCVQTAEGYFRKWKESNGNLSLPRDVTLAVFAVGAQST
EGWDFLYNKYQSSLFSTEKGQIEFALSTSQDQEKLQWLLDQSFRGEIIKTQEFPHILTFI
GRNPVGYPLAWKFLRENWNKIVQKFDLGSASLAHMVMGTTNQFSTKARLEEVKGFFSSLK
ENGSQLRCVQQTIETIEENIRWMDKNFDKIRIWLQNEKLQLL
NT seq 2829 nt   +upstreamnt  +downstreamnt
atggcgcctctgcccctcaaatggccacttgcaaacatgccgtttttcttttcctcactc
ttgactctcttagttgtgtcacctccttcttggtgtcagaatggtgctgctccatctcca
aaagctagtaatggagccccgttcccttggaataaaatgcgacttcctaagaatgtaacc
ccaattcattataatctcatgatccatgcaaatctcagcacactgactttccagggaacc
acagaaatagaaatcatagccagccagcccactagcaccatcatcctgcatagtcaccag
ctgcacatatctaaggccaccctccagagaagacctggggagattctgtctgaagaacca
ctgagggtcctggaatatccccctcatgagcaaattgcacttctggcccctgaaccactc
tttgctgggcgcttgtataccgttgtcatcgactatgctggtaacctgtctgagaacttc
catggattttataaaagcacctacaaaaccaaggaaggggaagtgaggatacttgcatca
acacagtttgaacccacagcagctagaatggcctttccctgctttgatgaacctgcccta
aaggcaagtttctccatcaatatcagaagggagtcaaagcacctggccatctccaacatg
cccttggtgagatctgtgactgttgccaaaggactcatggaagaccagtttgatgtcact
gtgaagatgagcacctacttggtcgctttcattgtttctgactttaagtctgtcagcaag
atgactaagagcggaatcaaggtctctgtgtatgctgtgccagacaagataaatcaagca
gattatgctctggatgccgcagtgactcttctagaattttacgaggattacttcagcatt
ccctatcctttacctaaacaagatcttgctgcaattcctgactttcagtctggtgctatg
gagaactggggcctgaccacatacagggaatctgctctgctatttgatgcagaaaagtct
tctgcatctagtaagcttggcatcacaatgactgtgtcccacgaacttgcccaccagtgg
ttcgggaacctggtcaccatggaatggtggaatgatctttggctcaatgaaggatttgcc
aagtttatggagtttgtctctgtcagtgtgacccatcctgaactaaaagttgaggaatat
ttctttggcaaatgttttgatgcaatggaggtggatgcactgaattcttcacaccctgtg
tccacacctgtggagaatcctgctcagattcgggagatgtttgatgatgtctcttatgat
aagggggcttgcattctgaatatgctgagagattatctgagtgcagatgcgtttaaaagt
ggaattgtgaagtatctcaataagtatagctatagaaacacgaagaatgatgacctgtgg
gacagcatggcaagtatttgccccacagatggcgcgcaaacagtggatggcttttgctct
agaagccaacgctcatcttcagcctcacactggcatcaggaaggcgtggatgtgaaaacc
atgatgaacacgtggacgctacagaagggctttcccctgataaccatctccatgagagga
cggaatgtgcacatgaagcaagaacattatatgaaggggtctgacagtgccctggagact
gggtacctgtggcatgttccactgacatttattaccagcaaatcaaactcagtccagaga
tttttgctgaagacaaagacagatgtgctcatcctcccagaagcagcggagtggatcaaa
tttaacgtgggaatgaatggctattatatcgtgcattacgagggagatggatgggattct
ttgactgaccttttaaaaagagcacacacagcagtcagcagtaatgatcgggcgagtctc
atcaacaatgcgtttcagcttgtcagcattggaaggctctcgattgaaaaagccttggat
ttaatcctgtacttgaaaaatgaaactgaaattatgcctgtgttccaaggattgaatgaa
ctggtacccatgtataagttaatggagaaaagagatatgaatgaggtggaaactcagttc
aagaccttcctcctcaggctgctgaggggccttattgataagcagacatggacagatgag
ggctccatctcagagagaatgcttaggagccagctcctccttcttgcctgtgtgcgcaag
tatcagccctgtgtgcagacggcagaaggctatttcagaaagtggaaggagtccaatgga
aatctgagcctccctcgcgatgtgaccttggcagtgtttgctgtaggggcccagagcact
gaaggttgggattttctttataataaatatcagtcttctttgttcagtacggagaaaggc
caaattgaatttgccctctctacgagccaagatcaggagaagcttcagtggctactagac
caaagttttaggggggagataataaaaactcaggagtttccacatattcttacattcatt
ggcagaaacccagtgggctatccattggcctggaagtttctgagagaaaattggaataaa
attgtacaaaagtttgaccttggctcagcttccttagctcacatggtaatgggaacaaca
aatcagttttctaccaaagcacggcttgaagaggtaaaaggatttttcagctctttgaaa
gaaaatggttctcaactccgttgtgttcaacaaaccatcgagaccattgaggaaaatata
cgctggatggataagaattttgataaaattagaatatggcttcaaaacgaaaagctgcaa
ctgctgtga

DBGET integrated database retrieval system