KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103732523
Entry
103732523         CDS       T03372                                 

Definition
(RefSeq) granzyme B-like
  KO
K01353  granzyme B [EC:3.4.21.79]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04210  Apoptosis
ngi04650  Natural killer cell mediated cytotoxicity
ngi04940  Type I diabetes mellitus
ngi05202  Transcriptional misregulation in cancer
ngi05320  Autoimmune thyroid disease
ngi05330  Allograft rejection
ngi05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103732523
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    103732523
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    103732523
  09163 Immune disease
   05320 Autoimmune thyroid disease
    103732523
   05330 Allograft rejection
    103732523
   05332 Graft-versus-host disease
    103732523
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    103732523
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ngi01002]
    103732523
Enzymes [BR:ngi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.79  granzyme B
     103732523
Peptidases and inhibitors [BR:ngi01002]
 Serine peptidases
  Family S1: chymotrypsin family
   103732523
SSDB
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Other DBs
NCBI-GeneID: 103732523
NCBI-ProteinID: XP_008829328
Position
Un
AA seq 235 aa
MQRLMILLAFFLPARMRAGEIIGGYEAKPHSRPYMALVQFLDENFVENQCGGFLIREDFV
LTAAHCLGSSMNVTLGAHNINEQEKTQQLIPVAKPIRHPDYNREKKVNDIMLLKLKSKAQ
RTKAVQTLKLPTGKAQVKPGSLCYVAGWGDTDARGTPSNTLQEVKIKVQADQLCESRFAN
YDKNTEICVGDPKTNHASFQGDSGGPLVCKKVAQGIVSYGRNDGTTPRVYTKVSS
NT seq 708 nt   +upstreamnt  +downstreamnt
atgcagcgactcatgatcctgttggctttctttctacccgccaggatgagggcaggggag
atcatcgggggatatgaggccaagccccactcccgtccctacatggccttggtccagttc
cttgatgagaattttgtggagaaccagtgtgggggcttcctgatacgggaggactttgtg
ctgaccgctgctcactgtttggggagctcaatgaatgtcaccctgggggcccacaacatc
aacgaacaggagaagacacagcagctcatccctgtggcaaaacccattcgacatccagat
tataaccgtgagaagaaggtcaatgacatcatgctgctgaagctgaagagcaaagcccag
cggactaaggctgtccagaccctcaagctgcccacaggcaaggcccaggtgaagccaggg
agtttgtgctatgtggctggctggggcgacacagacgcaaggggaacaccctcaaacaca
ctacaagaggtgaagatcaaagtgcaggcagaccagctctgtgagtcccgctttgcaaat
tatgacaagaacactgagatatgtgtgggagacccaaagacaaatcatgcttcctttcag
ggggattcaggagggccccttgtgtgcaagaaggtggcccagggcattgtctcctatgga
cgtaacgacgggacaactccacgagtctacaccaaagtctcaagttaa

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103739490
Entry
103739490         CDS       T03372                                 

Definition
(RefSeq) granzyme B-like
  KO
K01353  granzyme B [EC:3.4.21.79]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04210  Apoptosis
ngi04650  Natural killer cell mediated cytotoxicity
ngi04940  Type I diabetes mellitus
ngi05202  Transcriptional misregulation in cancer
ngi05320  Autoimmune thyroid disease
ngi05330  Allograft rejection
ngi05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103739490
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    103739490
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    103739490
  09163 Immune disease
   05320 Autoimmune thyroid disease
    103739490
   05330 Allograft rejection
    103739490
   05332 Graft-versus-host disease
    103739490
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    103739490
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ngi01002]
    103739490
Enzymes [BR:ngi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.79  granzyme B
     103739490
Peptidases and inhibitors [BR:ngi01002]
 Serine peptidases
  Family S1: chymotrypsin family
   103739490
SSDB
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Other DBs
NCBI-GeneID: 103739490
NCBI-ProteinID: XP_008838143
Position
Un
AA seq 283 aa
MRNSYPAQEECDCALSAPPSSRPFQAPKSPAGLESSHEAQLLDWQVPTRRLGFFTGEIIG
GHEAKPHSRPYMALVQVLDENSGKQCGGFLIREDFVLTAAHCFGSSMNVTLGAHNIVEKE
KTQQVIPVAKPIRHPDYNREKIVNDIMLLKLKSKAQRTKAVQTLKLPTSKAQVKPGSVCY
VAGWGRTDPRGTPSNTLQEVKIKVQADQVCESSFANYDKATEMCVGDPKTTHASLKGDSG
GPLVCKNVAQGIVSYGRKDGTTPGVCTKVSSFLHWIKKTMKRP
NT seq 852 nt   +upstreamnt  +downstreamnt
atgcgaaactcatacccagcacaggaggaatgtgactgtgctctctcagcccctcccagc
tccaggccattccaggctcccaaaagcccagcaggtctggagtcatcacatgaagcccaa
ctgctggattggcaggtgcccacaagaaggctgggtttctttacaggcgagatcatcggg
ggacatgaggccaagccccactcccgtccctacatggccttggtccaggtgctcgatgag
aattcggggaagcagtgtgggggcttcctgataagggaggactttgtgctgaccgctgct
cactgtttcgggagctcaatgaatgtcaccctgggggcccacaatatcgtggaaaaggag
aagacccagcaggtcatccctgtggcaaaacccattcgacatccagattataaccgtgag
aagatagtcaatgacatcatgctgctgaagctgaagagcaaagcccagcggactaaggct
gtccagaccctcaagttgcccacaagcaaggcccaggtgaagccagggagtgtgtgctat
gtggctggctggggcaggacagacccaaggggaacaccctcaaacacactgcaagaggtg
aagatcaaagtgcaggcagaccaggtctgtgagtccagctttgcaaattatgacaaggcc
actgagatgtgtgtgggagacccaaagacaactcatgcttccttaaagggggattctgga
gggccccttgtgtgtaagaacgtggcccagggcattgtctcctatggacgtaaagacggg
acaactccaggagtgtgcaccaaagtctcaagttttctacactggataaagaaaaccatg
aaacgcccctaa

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103744106
Entry
103744106         CDS       T03372                                 

Definition
(RefSeq) granzyme B-like
  KO
K01353  granzyme B [EC:3.4.21.79]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04210  Apoptosis
ngi04650  Natural killer cell mediated cytotoxicity
ngi04940  Type I diabetes mellitus
ngi05202  Transcriptional misregulation in cancer
ngi05320  Autoimmune thyroid disease
ngi05330  Allograft rejection
ngi05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103744106
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    103744106
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    103744106
  09163 Immune disease
   05320 Autoimmune thyroid disease
    103744106
   05330 Allograft rejection
    103744106
   05332 Graft-versus-host disease
    103744106
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    103744106
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ngi01002]
    103744106
Enzymes [BR:ngi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.79  granzyme B
     103744106
Peptidases and inhibitors [BR:ngi01002]
 Serine peptidases
  Family S1: chymotrypsin family
   103744106
SSDB
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Other DBs
NCBI-GeneID: 103744106
NCBI-ProteinID: XP_008843988
Position
Un
AA seq 264 aa
MQRLLILLAFFLPPRMRAGEIIGGHEAKPHSRPYMAFVQYLDENSGENQCGGFLIREDFV
LTAAHCDGSPMNVTLGAHNIKGQEKEKTQQVIPVVDRIRHPEYNPKTLVNDIMLLKLKSK
AQRTKAVQTLKLPTGKAQVKPGSVCYVAGWGDTDARGTPSNTLQEVKIKVQADQLCESRF
ANYDKEDQLCESSFADDYNKATQMCAGDPKKNQGSFEGDSGGPLVCKNVAQGIVSYGPPH
GITPGVYTKVSSFLHWIKKTMKRR
NT seq 795 nt   +upstreamnt  +downstreamnt
atgcagcgactcctgatcctgttggctttctttctaccccccaggatgagggcaggggag
atcatcgggggacatgaggccaagcctcactcccgtccgtacatggcctttgtccagtat
cttgatgagaattctggggagaaccagtgtgggggcttcctgatacgggaggactttgtg
ctgaccgctgctcactgtgatggcagcccaatgaatgtcaccctgggggcccacaacatc
aagggacaggagaaggagaagacccagcaggtcatccctgtggtggatcgcatccgccat
ccggaatataatcctaaaacgctagtcaatgacatcatgctgctgaagctgaagagcaaa
gcccagcggactaaggctgtccagaccctcaagctgcccacaggcaaggcccaggtgaag
ccagggagtgtgtgctatgtggctggctggggcgacacagacgcaaggggaacaccctca
aacacactgcaagaggtgaagatcaaagtgcaggcagaccagctctgtgagtcccgcttt
gcaaattatgacaaggaggaccagctctgtgagtccagctttgcagatgattacaacaag
gccacacagatgtgtgcgggagacccaaagaaaaaccaaggttcctttgagggcgattca
ggagggccccttgtgtgcaagaacgtggcccagggcattgtctcttatggacctccacac
gggataactccaggagtctacaccaaagtctcaagttttctacactggataaagaaaacc
atgaaacgccgctaa

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103751171
Entry
103751171         CDS       T03372                                 

Definition
(RefSeq) granzyme B-like
  KO
K01353  granzyme B [EC:3.4.21.79]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04210  Apoptosis
ngi04650  Natural killer cell mediated cytotoxicity
ngi04940  Type I diabetes mellitus
ngi05202  Transcriptional misregulation in cancer
ngi05320  Autoimmune thyroid disease
ngi05330  Allograft rejection
ngi05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103751171
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    103751171
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    103751171
  09163 Immune disease
   05320 Autoimmune thyroid disease
    103751171
   05330 Allograft rejection
    103751171
   05332 Graft-versus-host disease
    103751171
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    103751171
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ngi01002]
    103751171
Enzymes [BR:ngi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.79  granzyme B
     103751171
Peptidases and inhibitors [BR:ngi01002]
 Serine peptidases
  Family S1: chymotrypsin family
   103751171
SSDB
Motif
Pfam: Trypsin Trypsin_2
Other DBs
NCBI-GeneID: 103751171
NCBI-ProteinID: XP_008852757
Position
Un
AA seq 247 aa
MQQLLILLAFFLPARMRAGEIIGGYEAKPHSRPYMALVQFLDENFVENQCGGFLIREDFV
LTAAHCFGSSMNVTLGAHGPQQQEKTQQVIPVAKPIRHPDYNREKIVNDIMLLQLKSKAQ
RTKAVQTLKLPTGKAQVKPGSLCYVAGWGDTDARGTPSNTLQEVKIKVQADQVCESSFAN
YDKNTEMCVGDPKTNHAFFQGDSGGPLVCKNVAQGIVSYGRKDGTTPGVCTKVSSFLHWI
KKTMKRP
NT seq 744 nt   +upstreamnt  +downstreamnt
atgcagcaactcctgatcctgttggctttctttctacccgccaggatgagggcaggggag
atcatcgggggatatgaggccaagccccactcccgtccctacatggccttggtccagttc
cttgatgagaattttgtggagaaccagtgtgggggcttcctgatacgggaggactttgtg
ctgaccgctgctcactgtttcgggagctcaatgaatgtcaccctgggggcccacggccca
caacaacaggagaagacccagcaggtcatccctgtggcaaaacccattcgacatccagat
tataaccgtgagaagatagtcaatgacatcatgctgcttcagctgaagagcaaagcccag
cggactaaggctgtccagaccctcaagctgcccacaggcaaggcccaggtgaagccaggg
agtttgtgctatgtggctggctggggcgacacagacgcaaggggaacaccctcaaacaca
ctgcaagaggtgaagatcaaagtgcaggcagaccaggtctgtgagtccagctttgcaaat
tatgacaagaacactgagatgtgtgtgggagacccaaagacaaatcatgcattctttcag
ggggattctggagggccccttgtgtgtaagaacgtggcccagggcattgtctcctatgga
cgtaaagacgggacaactccaggagtgtgcaccaaagtctcaagttttctacactggata
aagaaaaccatgaaacgcccctaa

DBGET integrated database retrieval system