KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103733818Help
Entry
103733818         CDS       T03372                                 

Gene name
Mettl3
Definition
(RefSeq) methyltransferase like 3
  KO
K05925  mRNA m6A methyltransferase [EC:2.1.1.348]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ngi03019]
    103733818 (Mettl3)
Enzymes [BR:ngi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.348  mRNA m6A methyltransferase
     103733818 (Mettl3)
Messenger RNA biogenesis [BR:ngi03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    N6-methyltransferase complex
     103733818 (Mettl3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MT-A70 Ndc1_Nup
Motif
Other DBs
NCBI-GeneID: 103733818
NCBI-ProteinID: XP_008830928
Position
Un
AA seq 580 aa AA seqDB search
MSDTWSSIQAHKKQLDSLRERLQRRRKQDSGHLDLRNPEAALSPTFRSDSPVPTAPTCSG
PKPSTVSVIPELATDPELEKKLLHHLSDLALTLPTDAVSICLAISTPDAPATQDGVESLL
QKFAAQELIEVKRGLLQDDAHPTLVTYADHSKLSAMMGAVAEKKGLGEVAGTITGQKRRA
EQDSTTVAAFPSSLASGLASSVSEPAKEPAKKSRKHAASDVDLEIESLLNQQSTKEQQSK
KVSQEILELLNTTTAKEQSIVEKFRSRGRAQVQEFCDYGTKEECMKASDADRPCRKLHFR
RIINKHTDESLGDCSFLNTCFHMDTCKYVHYEIDACMDAEGPGSKDHAPSQELALTQSVG
GDSSADRLFPPQWICCDIRYLDVSILGKFAVVMADPPWDIHMELPYGTLTDDEMRRLNIP
VLQDDGFLFLWVTGRAMELGRECLNLWGYERVDEIIWVKTNQLQRIIRTGRTGHWLNHGK
EHCLVGVKGNPQGFNQGLDCDVIVAEVRSTSHKPDEIYGMIERLSPGTRKIELFGRPHNV
QPNWITLGNQLDGIHLLDPDVVARFKQRYPDGIISKPKNL
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacacgtggagctcgatccaggcccacaagaagcagctcgactcgctgcgtgag
cggctgcagcgcaggcggaagcaggactcggggcacttggatctacggaatccagaagca
gcactgtccccaaccttccgtagtgatagcccagtgcctactgcacctacctgtagtggc
cctaagcccagtacagtttcagtcattcctgaattagctacagacccagagttagagaag
aagttgctacaccacctctcggatctagccttaaccttgcccactgatgctgtgtccatc
tgtcttgccatctctacgccagatgcacctgccactcaagatggggtagaaagccttcta
cagaagtttgcagctcaggagttgattgaggtaaagcgaggtctcctacaagatgatgca
catcccactcttgtgacctatgctgaccactccaaactctctgcaatgatgggtgctgtg
gcagaaaagaaaggccttggagaagtagcagggactatcacggggcagaaacgacgggca
gaacaggactcaacaacagtagctgcttttcccagctctttagcctctggactggcctct
tcagtatcagaaccagctaaggagccagctaaaaaatcaaggaagcatgctgcttcagat
gttgatctggagatagaaagtcttttgaaccaacagtctactaaagaacaacaaagcaag
aaggtcagtcaggagatcctagagctattaaataccacaacagccaaggaacaatccatt
gttgaaaagtttcgctcacgaggtcgggcccaagtgcaagaattttgtgactatgggacc
aaggaggagtgcatgaaagccagtgatgctgatcgaccttgtcgcaagctgcacttcaga
cgaattatcaacaagcacacagatgagtctttaggtgactgctctttccttaacacatgt
ttccacatggatacgtgcaaatatgttcactatgaaattgatgcttgcatggatgctgag
ggtcctggaagcaaggaccatgcaccaagccaggagctcgctcttacacagagcgttggg
ggtgattctagtgcagatcgactctttcctcctcagtggatctgttgtgacatccggtac
ctggacgtcagtatcttgggcaagtttgcagtagtgatggctgacccaccttgggatatt
cacatggagctaccctacgggaccttgacagacgacgagatgcgcaggctcaacatacca
gtgcttcaggatgacggctttcttttcctttgggtcacaggcagggccatggaattaggc
agagagtgtctgaacctctggggttacgaacgtgtagatgaaattatctgggtgaagaca
aatcaactgcagcgcatcattaggacaggccgtacaggtcactggttgaaccatgggaag
gaacactgcttggttggtgttaaaggaaatcctcaaggctttaaccagggtctggactgt
gatgtgattgtagctgaggttcgttccaccagtcacaaaccagatgaaatttatggcatg
attgagagactctcccctggtacccgcaagattgagctctttggacgaccacacaatgtg
caacctaactggattactctgggaaatcaactggatgggatccacctgctagacccagat
gtggttgcacggtttaagcaaaggtatccagatggtatcatctcaaaacctaagaattta
taa

DBGET integrated database retrieval system