KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103734571Help
Entry
103734571         CDS       T03372                                 

Gene name
Dock6
Definition
(RefSeq) dedicator of cytokinesis 6
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ngi04131]
    103734571 (Dock6)
Membrane trafficking [BR:ngi04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    103734571 (Dock6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 DOCK_N
Motif
Other DBs
NCBI-GeneID: 103734571
NCBI-ProteinID: XP_008831786
Position
Un
AA seq 2083 aa AA seqDB search
MAALERRAFAHKINRTVAAEVRKQVSRERSGSPHSSRRSSSSLGVPLTEVMEPVDFEDVL
LSHPPDVEPGPLRDLIEFPADDLELLKQPRECRTTESGIPEDGKLDAQVRAAVAMYTEDW
VIVHRRYQHLSPSYSPVTTDTQREQQKGLTCQVFEQDASGDERTGPEDMDDSRHCSGSPE
DTPRSSGASGIFNLRNLAADSLLPSLLERAAPEDMDQRNEALRRQHRTRALLTLYPAPDE
DEAVERCTCPEPPREHFGQKILVKCLSLKFEIEIEPIFGTLALYDVREKKKISENFYFDL
NSDSMKGMLRAHGTHPAISTLARSAIFSVTYPSPDIFLVVKLEKVLEQGDISDCCEPYMV
MKEMDMAKNREKLDKLRLAAEQFCTRLGRYRMPFAWTAVHLANIVSSAGQQDRDSDSEGE
RRPTWTERRRRGTQDRASSGDDACSFSSFRPATLTVTNFFKQEAERLSDEDLFKFLADMR
RPSSLLRRLRPVTAQLKIDISPAPENPHFCLSPELLHVKPYPDPRGRPTKEILEFPAREV
YTPHTSYRNLLFVYPHRLNFSSRQGSVRNLAVRIQYMAGEDQSQALPVIFGKSSCSEFTR
EAFTPVVYHNKSPEFYEEFKLRLPACMTDNHHLFFTFYHISCQPRPGMALETPVGFTWIP
LLQHGCLRTGPFCLPVSVDQPPPSYSVLTPDVALPGMRWVDGHKGVFSVELTAASSVHPQ
DPHLDRFFTLVHVLEEGSFPFRLKDTVLSEGTMEQELRASLTALRLASPEPLVAFSHHVL
DKLVHLVVRPPIITGQIVNLGRGAFEAMAHVASLVHRSLEAVQDSRGHCPLLAAYVHYAF
RLPGGELSLPGGASLATLQPATLARSSGRPASLYLTRSKSISSSNPDLAVAPGSVDDEVA
RILASKGVDRSHSWVNSAYAPGGSKAVLRRIPPYCGADPRQLLHEELALQWVVSGSTVRE
MVLQHAWFFFQLMVKSMQLHLILSQRLNTPRKLRFPGRFLDDISALVGSVGLEVITRVHK
DVEVAERLNASLAFFLSDLLSIADRGFVFRLVQAHYKQVATRLQSSPNPASLLTLRMDFT
RILCSHEHYVTLNLPCCPLSPPASPSPSLSSTTSQSSAFSSQSPDPKVTSMFELSGTFRQ
QHFLSGLLLTELALALEPEAEGASVLHKKAISAVHSLLCSHDIDPRYTEPTVKARVAELY
LPLLSIARDTLPRLHSFTEGSGQRSRLVSMLDSDTEGEGDIGGTISPSVAIAIAGGPLAP
SSRSSISQGPSTVSRSGYPLSAESSRTLMICVLWVLKNAEPTLLQRWAADLALSQLGRLL
ELLNLCLAAFEYKGKKAFERINSLTFKKSLDMKARLEEAILGTIGARQEMVRRSRERSPF
GNQDNVRWRKSVTHWRQTSDRVDKTKNEMEHEALVDGNLATEASLVVLDTLEIIVQTVML
SETRESILGAVLKVVLYSLGSTQSASFLQHGLATQRALVSKFPELLFEEDTELCADLCLR
LLRHCGSRISTIRTQASASLYLLMRQNFEIGHNFARVKMLVTMSLSSLVGTTQNFSEEHL
RRSLKTILTYAEEDVGLRDSTFTEQVQDLMFNLHMILTDTVKMKEHQEDPEMLIDLMYRI
ARGYQGSPDLRLTWLQNMAGKHAELGNHAEAAQCMVHAAALVAEYLALLEDSRHLPVGCV
SFQNISSNVLEESAISDDILSPDEEGFCSGKHFTELGLVGLLEQAAVYFTMGGLYEAVNE
VYKNLIPILEAHRDYKKLAAVHGKLQEAFSKIMQQSSGWERVFGTYFRVGFYGLRFGDLD
EQEFVYKEPSITKLAEISHRLEEFYTERFGEDAVEIIKDSNPVDKSRLDPQKAYIQITYV
EPYFDTYELKDRVTYFDRNYGLRTFLFCTPFTPDGRAHGELAEQHKRKTLLTTDHAFPYI
KTRIHVCHREETVLTPVEVAIEDMQKKTRELAFATEQDPPDAKMLQMVLQGSVGPTVNQG
PLEVAQVFLADIPEDPKLFRHHNKLRLCFKDFCKKCEDALRKNKALIGPDQKDYHRELER
HYCRLREALQPLLTQRLPQLLAPSSASLRNSLKRRTSFQKADL
NT seq 6252 nt NT seq  +upstreamnt  +downstreamnt
atggcggccttggagcgccgcgcctttgctcacaagatcaacaggacggtagccgctgag
gtgcggaagcaggtgtcccgggaacgcagtggctcccctcattcaagcagacgctctagc
agctcccttggggtccccttgacagaggttatggagcctgtggacttcgaggatgtcctt
ctaagccatccaccggatgtggagcctggtcctctgagggacttgatagaatttccagct
gacgatttggaactgctcaagcagccccgggaatgtcggaccacagagtctgggatcccc
gaggatggaaaattggatgcccaggtgagggccgccgtggccatgtacacagaagactgg
gtcattgttcacagaaggtatcagcacctgagtccatcatacagccctgttaccacagac
acacagagagagcagcagaagggcctcacctgccaagtcttcgagcaggacgcctcaggg
gacgagaggacaggtccagaggacatggatgattcccggcactgctcgggctccccagag
gacacccctcgaagcagcggagcctctggcattttcaacctaaggaacttggccgctgac
tcacttctgccgtccttgctggagcgggcagcccctgaggacatggaccagcgtaatgaa
gccctgcggcggcagcaccgcacccgtgccctgcttaccctataccctgcacctgatgag
gatgaggctgtggaacgctgtacttgcccagagccaccccgggagcactttggacagaag
atccttgtgaaatgtctgtcgctcaagtttgagatagaaattgagccgatcttcggcacc
ttggccctgtatgacgttcgtgagaaaaagaagatttcggaaaatttctactttgatctg
aactcggactccatgaaagggatgctccgggcccatggaacccaccctgccatctccacc
ctggcccgctctgccatcttttctgtgacctacccctctcccgacatcttcctggttgtc
aagctggagaaggtgcttgaacagggtgacattagtgactgctgcgagccctacatggtg
atgaaggagatggacatggcgaagaacagagagaagctggacaaactgcgcctggcagcc
gagcagttctgcacccgactgggtcggtaccgcatgccctttgcttggacggcagtgcac
ttggctaacatcgtgagcagcgctggccaacaggaccgtgattccgactctgagggcgag
cgtagacccacttggactgaacgccgccgtcggggaacccaggatcgagccagtagtggg
gatgatgcctgtagcttctctagcttccgcccggccacattaactgtcaccaactttttt
aagcaggaggctgagcggctgagtgatgaggaccttttcaagtttctggcagacatgcgg
aggccgtcgtccctactgaggcgcctgcgacctgtgactgctcagctcaagattgacatc
tctccagctcctgaaaacccacacttctgcctgtcccccgagctacttcatgtcaagccc
tacccagaccccaggggacggcccaccaaggagatcctggagttccctgcccgtgaggtc
tacacccctcacacttcctataggaatctcctgtttgtgtacccacacagactcaacttc
agcagccgccagggctctgtgcgcaacctggccgtgcggatccaatacatggctggtgag
gatcagagccaggcccttccggtcatctttgggaaatctagctgcagtgagttcacccgt
gaggccttcacaccagtggtctaccataacaagtcccctgaattctatgaagaattcaag
ctgagacttcctgcttgcatgactgacaaccatcacctcttttttacattctaccacatc
agctgccagcctcggccgggcatggccctggagacacctgtgggcttcacttggatccca
ttactccaacatggctgcctgaggaccggtcccttctgcctgcccgtgtctgtggaccag
cctccacccagctactctgtgctcacccctgatgtggcactgccgggcatgcgctgggtg
gacggtcacaagggtgtgttcagtgtggagctcacagccgcatcatctgtgcacccccag
gacccccacttggataggttcttcaccctggtacatgttctcgaagaagggtcctttcca
ttccgcctcaaggatacagtgctgagcgagggcaccatggagcaggagctacgggccagc
ctgactgcgctgcgcctcgctagccctgagcctcttgtggccttttcccaccatgtcctt
gacaagctggtccacttggttgtgcgcccccccatcatcactggccagatagtgaacctg
ggccggggggcctttgaagccatggctcatgtagccagccttgtgcatcggagcctggag
gccgtccaggattctcgtggtcactgtccactgctggctgcctatgtccactatgccttt
cgtcttcctggtggtgaacttagcctgccaggcggggcctctctggctactctgcagcca
gccacactggctcgcagctctggccgccctgcaagcctctacctgacacgttctaagagc
atcagtagcagcaaccctgacctggccgtggcccctggctccgtggacgatgaggtagcc
cgcatcctagccagcaagggcgtcgatcgctcacactcctgggtgaattctgcttatgct
cctggaggcagcaaggctgtgctgaggcggatacccccttactgtggggctgaccccaga
cagctcctgcatgaggagctggctctgcagtgggtggtgagtgggagcactgtacgagag
atggtcctgcagcacgcctggttcttcttccagctcatggtgaaaagcatgcaactgcac
ctgattctgagccagcgcctgaacacaccccgaaaactgcgctttcctgggcgcttcctg
gatgacatctcagccttggtgggctctgtgggtctagaggtcatcacacgggtccacaag
gatgtggaagtggctgaacgtctcaacgccagcctggctttcttcctcagcgacctgctg
tctatagcagacaggggcttcgtgttccgcctggtacaagctcactacaagcaggtggcc
acccggctacagtcatcccccaacccagcctccctgctgaccctgcgcatggacttcacc
cgaatcctgtgcagccacgagcactacgtgaccctcaacctcccttgctgtcccctgtcg
ccgccagcctccccctccccctccttgtcctctaccacctcccagagttccgccttctcc
agccagtctcccgaccccaaggtgaccagcatgtttgagctgagtggaaccttccgtcag
cagcattttctgtctggacttctgctgactgaactggccctggccctggagcctgaggct
gagggggcatccgttttgcacaagaaggccatcagtgcagtgcacagcctgctatgcagc
cacgacattgaccctcgctacacagagcccactgtgaaggccagggtggctgagctgtac
ctgcccctactctccattgccagggacacactgccacggctgcacagcttcacagagggc
tcaggtcagcggtcaagacttgtgtccatgctggactcggacacagaaggtgaaggggac
attggaggcaccatcagcccgtctgtggccattgccattgctggggggccccttgctcct
agctctcgctccagcatctcccagggaccttcaaccgtgtcccgctcggggtatcccctc
tctgctgagtccagccggaccttgatgatatgtgtactgtgggtcttgaaaaatgcagag
ccaaccctcctgcagcgctgggctgctgacctggccctgtcacagctgggacgcctcctg
gagttgctcaacctctgtctggctgcctttgagtataaggggaaaaaggcctttgagcga
attaacagcctcacattcaagaagtcattagacatgaaagcccggctagaggaggccatc
ttgggcaccattggggcacggcaggagatggtgcggcggagtcgggagaggagtccattt
ggaaaccaagacaacgttcgctggcgtaagagtgtcacacactggagacagacctcagac
cgtgtggacaagactaagaatgaaatggaacatgaagccctagtggatggtaacctggca
acagaagctagcttggtggttctggacaccctggagatcattgtgcagacggtgatgctg
tcagagacccgggagagcatcctgggtgctgtgctcaaagttgtgctgtacagtctgggg
agcacccagagtgccagcttcctgcagcatggcctagccacccagcgggctctggtatcc
aagttcccggagctgctgtttgaagaggacacggagctgtgtgccgacctgtgcctgagg
cttctgcgacactgtggcagccgcatcagcaccatccgcacacaagccagcgcctccctc
tacttgctcatgcgccagaactttgagatcggccataattttgcccgtgtgaagatgctg
gtgaccatgtcactctcatccctcgtgggaacaacacagaacttcagtgaagagcacctg
aggcggtccctcaagaccatcctgacctacgcagaggaggacgtagggctgcgggatagc
acctttacagagcaggttcaggacctcatgttcaacctgcacatgatcctgacagacaca
gtaaagatgaaggagcaccaggaagaccctgaaatgcttattgacctcatgtacagaatt
gcccgagggtaccaaggctcaccagacttgcgcctgacttggcttcagaacatggctggc
aaacacgcagagttgggcaaccatgcagaagctgcccaatgcatggtgcatgcagctgcc
ctggtggctgagtacctggccctactggaggacagccgccatctgcctgtgggctgcgtg
tccttccagaacatctcatccaatgtgctggaggaatctgccatctcagatgacatcctg
tcaccagatgaagagggtttctgctctgggaagcacttcacagagctggggctggtggga
ctgttggaacaggctgctgtctacttcaccatgggtggactgtatgaggcagtgaatgag
gtctacaaaaacctcatccccatcctggaagcccacagagactacaagaagctggctgcg
gtgcatggaaaactgcaggaggccttcagcaagatcatgcagcagagctctggctgggag
cgcgtttttgggacatatttccgagtgggtttctacggcctgcgttttggggacctggat
gagcaggagtttgtgtacaaggaaccatccatcacgaaactggcagagatttcacaccgg
ctggaggagttctacacagagaggttcggagaggatgcagtggagatcatcaaagattct
aacccagtagacaagtccaggctggacccacagaaagcctacatccagatcacctatgta
gagccatactttgacacttacgagctcaaggaccgggtgacctactttgaccgcaactat
gggctgcggaccttcctcttttgcacacctttcactcctgatgggcgggcacatggggag
ctggcggaacaacacaaacgcaagaccctgctcaccacagatcatgcctttccatacatc
aagacacgcatccatgtgtgccaccgtgaggagacagtactgacaccagtggaggtagcc
attgaggacatgcagaagaagacccgggagctggcgtttgccactgagcaggaccctccg
gatgccaagatgctgcaaatggttctacaaggctctgtggggcctaccgtgaaccagggt
cccttggaggtagcccaggtatttctggcagacatcccagaagaccccaagctcttccga
caccacaacaaactgcgactctgtttcaaggatttctgcaagaagtgtgaggacgcactg
aggaagaacaaggccttgattgggccagaccagaaggactaccatcgggaactagaacgc
cactactgccgtttgcgagaggccctgcagcccctgctcacccagcgcctgccccagctg
ctggcaccaagctctgccagcctcaggaactccctgaagagaagaacaagcttccagaag
gctgacctctga

DBGET integrated database retrieval system