KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103734785Help
Entry
103734785         CDS       T03372                                 

Gene name
Crem
Definition
(RefSeq) cAMP responsive element modulator
  KO
K09052  cAMP response element modulator
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103734785 (Crem)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ngi03000]
    103734785 (Crem)
Transcription factors [BR:ngi03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    103734785 (Crem)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: pKID
Motif
Other DBs
NCBI-GeneID: 103734785
NCBI-ProteinID: XP_017653867
Position
Un
AA seq 313 aa AA seqDB search
MSKCSRKKCIRTNVRQMTMETVESQQDRSAALSVAECSSAHKQTQTRQISVPTLAQVSVA
GSGTGRGSPAVTLVQLPSGQTVQVQGVIQTSHPSVIQSPQIQTVQVATIAETDDSAESEG
VIDSHKRREILSRRPSYRKILNELSSDVPGIPKIEEEKSEEEGTPPNIATMAVPTSIYQT
STGQYIAIAQGGAIQISNAASDGVQGLQALAMTNSGAPLPGATIVQYAAQSADGTQQFFV
PGSQVVVQDEETELAPSHMAAATGDMPTYQIRAPTTALPQGVVMAASPGSLHSPQQLAEE
ATRKRELRLMKNR
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaatgtagcaggaaaaagtgtattaggacaaatgtaagacaaatgaccatggaa
acagttgaatctcagcaggatcgaagtgcggcgctttctgtggcagagtgcagctctgct
cataagcagactcagactcgtcaaatttctgttcctactctggctcaggtttctgtagct
ggatcaggcactggaagaggctccccagctgtgactctagtacagttgccttcgggccag
actgtacaggtccagggagtaattcagacatcacatccatcggtcattcagtcaccacaa
atacaaactgttcaggtagcaacaattgcagagacagatgattctgcagaatcagaaggt
gtaattgattctcataaacgtagagaaatcctttcacgaagaccctcatatagaaaaata
ctgaatgaactttcctctgatgtgcctggtattcccaagattgaagaagaaaaatcagag
gaagaaggaacaccacctaacattgctaccatggcagtaccaactagcatatatcagact
agcacggggcaatacattgctatagcccaaggtggagcaatccagatttctaacgcagca
tctgatggtgttcagggactccaggcattagcaatgacaaactcaggagctcctctgcca
ggtgctacgattgtacagtatgcagcacagtcagctgatggcacacagcagttctttgta
ccaggcagccaggttgttgttcaagatgaggaaactgaacttgccccaagtcacatggct
gctgccacaggtgacatgccaacttaccagatccgggctcctactacggctttgccacag
ggtgtggtgatggctgcatcaccaggaagtctgcacagtccccagcaactagctgaagaa
gcaactcgtaagcgggagctgaggctgatgaaaaacaggtaa

DBGET integrated database retrieval system