KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103737131Help
Entry
103737131         CDS       T03372                                 

Gene name
Zdhhc18
Definition
(RefSeq) zinc finger DHHC-type containing 18
  KO
K16675  palmitoyltransferase ZDHHC9/14/18 [EC:2.3.1.225]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Brite
Enzymes [BR:ngi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     103737131 (Zdhhc18)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC Imm17
Motif
Other DBs
NCBI-GeneID: 103737131
NCBI-ProteinID: XP_017654558
Position
Un
AA seq 367 aa AA seqDB search
MPGPDAGGAVAGGRGGPGPAPSAVRCSGSGSGSLGRPRRKWEVFPGRNRFYCGGRLMLAG
HGGVFALTLLLILSTTILFFVFDCPYLARELTPAIPIIAAILFFFVMSCLLQTSFTDPGI
LPRATVCEAAALEKQIDNTGSSTYRPPPRTREVMINGQMVKLKYCFTCKMFRPPRTSHCS
VCDNCVERFDHHCPWVGNCVGRRNYRFFYAFILSLSFLTAFIFACVVTHLTLCSQGVNFL
STLKKTPASVLELVICFFSIWSILGLSGFHTYLVASNLTTNEDIKGSWSSKRGGEASVNP
YSHKSIITNCCAVLCGPLPPSLIDRRGFVQSDTVLPSPIRSDKPACGAKPDASMEDTCQD
FAISCTA
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgccgggcccggacgcagggggcgctgtggcgggaggccgcggcggtccggggcccgcg
ccgagcgcagtgcgctgcagcggcagcggcagcgggagcctgggccggccgcgccgcaag
tgggaggtgttcccgggccgcaaccgcttctactgcggcggccgcctcatgttggccggc
cacggcggcgtcttcgcgctcacgctgctgctcatcctcagcaccacgatcctcttcttc
gtcttcgactgtccctatctagcccgagaactgaccccggccatccccatcatcgctgcc
atcctcttcttcttcgtcatgagctgcctcctgcagacgagtttcaccgaccctggcatc
ctgccccgggccaccgtctgtgaagcagctgccctggagaaacagatcgacaacacaggc
agctccacataccggccgccccctcggacccgggaggtgatgatcaacgggcagatggta
aagttgaagtactgtttcacctgtaagatgtttcggcctccccggacctcacattgcagt
gtctgtgacaactgtgtggaacgatttgaccatcactgcccctgggtgggcaactgtgtt
gggagacggaactaccgcttcttttatgcgtttattctctccctctcattcctgacggcc
ttcatctttgcctgtgtggtcacccacctgacgctgtgttctcagggagtcaacttcctc
tccactctgaagaagacaccggcgagcgtgctggaattggtgatctgcttcttttccatc
tggtccatcctgggcctctcagggtttcacacttacctcgtcgcctccaacctgacaact
aacgaagatatcaaaggctcgtggtccagcaagaggggtggtgaagcctctgtcaacccc
tatagccataaaagtattatcactaactgctgtgctgtgctgtgtggccccctacctccc
agcctgattgaccggaggggatttgtccagtctgacaccgtgttgccctcacctatcaga
agtgacaagcccgcctgtggagccaagccagatgccagcatggaggacacctgtcaggac
tttgccatctcctgcacagcctaa

DBGET integrated database retrieval system