KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103738050Help
Entry
103738050         CDS       T03372                                 

Gene name
Minpp1
Definition
(RefSeq) multiple inositol-polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi00010  Glycolysis / Gluconeogenesis
ngi00562  Inositol phosphate metabolism
ngi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103738050 (Minpp1)
   00562 Inositol phosphate metabolism
    103738050 (Minpp1)
Enzymes [BR:ngi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     103738050 (Minpp1)
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     103738050 (Minpp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 DUF4708 SID
Motif
Other DBs
NCBI-GeneID: 103738050
NCBI-ProteinID: XP_008836079
Position
Un
AA seq 481 aa AA seqDB search
MLRGPQHRLRASVAPAAALAAALLSAFGRCSVPERSDPAASALSPYFGTKTRYEDVNPEL
LADPVAPRRDPELPAGTCTPVQLVALIRHGTRYPTTKQIRKLRQLQGVLQAHGPGDGRRG
LGAALADWPLWYEDWMDGQLVEKGRQDMRQLALRLAGLFPDLFRRENFGHLRVVTSSKHR
CVDSSAAFLQGLWQHYHPGLPPPDVADMDCGPPRINDKLMRFFDHCEKFLTQVERNATAL
YHVQAFKTGPEMQNILKKVAATLQVPVDNLNADLIQVAFFTCSFDLAIKGVKSPWCDVFD
IDDAKVLEYLNDLKQYWKRSYGYTINSRSSCALFQDIFQHLDRAVEQKQRSQPVSSPVIL
QFGHAETLLPLLSLMGYFKDKEPLTAYNYKEQVHRKFRSGHIVPYASNLIFVLYHCEDAK
TPKEEFQVQMLLNEKVLPLAHSQGTVALYEDVKSHYKDILLSCHTSEECELPKVNITSDE
L
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgcggtccccagcaccgcctccgggcctccgtagcgcccgctgcggccctggct
gcggcgctgctctcggcgttcggtcgctgctctgttccggagcgcagcgacccggcggcc
tcggcgctcagtccttacttcggcacgaagactcgctatgaggacgtcaacccggagctg
ctggcggaccctgtggcgccgcggcgggaccctgagctgccggcgggaacctgtaccccg
gtgcagctcgtcgccctcatccgccacggcacccgctaccccacgaccaagcagatccgc
aagctgagacagctacagggggtgctgcaggcccacgggcctggggatggccggcgcggc
ctgggcgccgcgctggccgactggccgctgtggtacgaggactggatggacgggcagctg
gtggagaaggggcggcaagacatgagacagctggccctacgcctggctggcctcttcccg
gacctcttcaggcgagagaacttcggccacctacgggtggtcaccagctccaagcaccgc
tgtgtggacagcagcgccgccttcctgcaagggctatggcagcactatcaccccgggttg
ccgccgcccgacgtcgcagatatggactgtggccctccaagaattaatgacaagctgatg
agattctttgatcattgtgagaagtttttgactcaagtggaaaggaatgctacagctctt
tatcatgtacaagccttcaaaactggccctgaaatgcagaatattttgaaaaaagttgca
gctactttgcaagtgccagtagacaatttgaatgcagatttaattcaggtagcttttttc
acctgttcatttgacctggcaattaaaggtgttaaatctccttggtgtgatgtttttgac
atagatgatgcaaaggtactggaatatttaaacgatctgaagcagtattggaaaagaagc
tatggctataccattaacagccgatccagctgcgccctgttccaggacatctttcagcac
ttggacagagcggttgagcagaagcaaaggtctcagccagtttcctctccagtcatcctg
cagtttggtcatgcagagacccttcttccactgctctctctcatgggctacttcaaagac
aaggagcccctgacagcttataattacaaggagcaagtccatcggaagttccgaagcggc
cacatcgtaccttatgcctcaaacctaatatttgtgctttaccattgtgaagatgcaaag
acgcctaaagaagaattccaagtgcagatgctgctgaatgaaaaagtgttacccttggct
cactcacaagggaccgttgctttgtatgaggatgtgaagagccactacaaggacattctt
ctgagctgtcataccagtgaagagtgtgagctaccaaaggtgaacatcacatctgatgag
ctctga

DBGET integrated database retrieval system