KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103738080Help
Entry
103738080         CDS       T03372                                 

Gene name
Htr4
Definition
(RefSeq) 5-hydroxytryptamine receptor 4
  KO
K04160  5-hydroxytryptamine receptor 4
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04020  Calcium signaling pathway
ngi04024  cAMP signaling pathway
ngi04080  Neuroactive ligand-receptor interaction
ngi04726  Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    103738080 (Htr4)
   04024 cAMP signaling pathway
    103738080 (Htr4)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103738080 (Htr4)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    103738080 (Htr4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ngi04030]
    103738080 (Htr4)
G protein-coupled receptors [BR:ngi04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    103738080 (Htr4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1
Motif
Other DBs
NCBI-GeneID: 103738080
NCBI-ProteinID: XP_008836111
Position
Un
AA seq 388 aa AA seqDB search
MDKLDANVSSNKGFGSVEKVVLLTFLSAIILMAILGNLLVMVAVCRDRQLRKIKTNYFIV
SLAFADLLVSVLVMPFGAIELVQDIWIYGEMFCLVRTSLDVLLTTASIFHLCCISLDRYY
AICCQPLVYRNKMTPLRIALMLGGCWVLPMFISFLPIMQGWNNIGIVDLIEKRKSNHSSN
STYCIFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAHQIQLLQRAGAPSEGRP
QPADQHSTHRMKTETKAAKTLCIIMGCFCLCWAPFFVTNVVDPFIDYSVPGQVWTAFLWL
GYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYRRPSILGQTVPCSTTTINGSTHVLRD
AVECGGQWESQCHPTATSPLVAAQSSDT
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggacaaacttgatgctaatgtgagttccaacaagggttttgggtcagtggagaaggtt
gtgctgctcacatttctctcagcgattatcctgatggccatcctgggcaacctgctggtt
atggtggctgtatgcagggacagacagctcaggaaaataaaaaccaattatttcattgta
tctcttgcctttgccgatctgctggtttcggtgttggtgatgccctttggtgccattgag
ctggttcaagacatctggatttatggggagatgttttgtctggtccggacctctctggat
gtcctgctcaccacagcatcaatttttcacctgtgctgcatttcactggataggtactat
gccatctgctgccaacctctggtttacagaaacaagatgacccctctacgcatcgcgttg
atgctcggtggctgctgggtcctccccatgttcatctcttttctccccataatgcaaggc
tggaacaacattggtatagttgacttgatagagaaaaggaagtccaaccacagctctaac
tcaacatactgcatcttcatggtcaacaaaccctatgccatcacctgctccgtggtggcc
ttctacattccgtttctcctcatggtgctggcctattaccgcatctatgtcaccgcaaaa
gagcatgcccaccagatccaattgttacaacgagctggagctccctctgaaggcaggccc
cagccagcagaccagcacagtacccatcgcatgaagacagaaaccaaggcagccaaaaca
ttgtgcatcatcatgggctgcttctgtctctgctgggctcccttcttcgtcacaaatgtt
gtggatcctttcatagactacagcgtccctggacaggtgtggactgctttcctttggctt
ggctatatcaattcggggttgaacccgtttctctatgccttcttgaataaatcttttaga
cgtgcctttctcatcatcctctgctgtgatgatgaacgctacagaaggccttccattctg
ggccagacagtcccctgttcaaccacaaccattaatggatccacacatgtgctgagggat
gcagtggaatgtggtggccaatgggagagtcagtgccaccctacagcaacttctcctttg
gtggctgctcagtccagtgacacttag

DBGET integrated database retrieval system