KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103738827
Entry
103738827         CDS       T03372                                 

Gene name
Rdh5
Definition
(RefSeq) retinol dehydrogenase 5
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    103738827 (Rdh5)
Enzymes [BR:ngi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     103738827 (Rdh5)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR
Other DBs
NCBI-GeneID: 103738827
NCBI-ProteinID: XP_008837214
Position
Un
AA seq 318 aa
MWLPLLLGALLWAVLWLLRDWQSLPASDAFIFITGCDSGFGHLLALXLDQRGFRVLASCL
TPSGAEDLQQMASSRLHTALLDITDPQSVQQVAKWVETHVGEAGLFGLVNNAGVAGITGP
TPWLTRDDFHRGLNVNTLGPIGATLVLLPLLQQAQDRVVNITSVLGHLAANGGGYCVSKF
GLEAFSESLRWDVAPSGVRVSIVEPVFFQTPMTNLESLENTLQACWARLPPATQACYGED
FLTTYLQVQRHIMNLICDPDLTKVTSCLEHGLTARHPXTRYSPGWDAKLLWLPASYLPAG
LVDAVFTWVLPKPAQSIY
NT seq 957 nt   +upstreamnt  +downstreamnt
atgtggctgcctctgctgctgggagccttgctgtgggcagtgctgtggttgctcagagac
tggcagagcctgcctgccagcgatgctttcatcttcatcacgggctgtgactcaggcttt
ggacaccttctggcattgtgactggaccagaggggcttccgagtactggccagctgcctg
accccctctggggcagaagacctacagcagatggcctcctcccgcctccacacagccctg
ctggatattactgatccccagagtgtccagcaggttgccaagtgggtagagacacacgtt
ggggaagcagggctttttggtctggtgaataatgctggtgtggctggtatcactgggccc
acaccatggctgacaagagatgatttccatcgagggctgaacgtgaacacattgggtccc
atcggggcgacccttgtactgctgcccctgctacagcaggcccaggaccgggtggtcaac
atcaccagtgtcctgggtcacctggcagccaatggagggggctactgtgtctccaagttt
ggcctggaggccttctctgaaagcctgaggtgggacgtggctccatctggggtacgagtc
tccattgtggagcccgtcttcttccaaacccctatgaccaacctggaaagtctagaaaac
actctgcaggcctgttgggcccggctacctccagctacacaggcctgctatggagaggac
ttccttaccacttatctacaagtgcagagacacatcatgaacctgatctgtgacccagac
ctaacgaaggtgactagctgcctggagcacgggctgactgctcgtcacccctgaacccgc
tacagcccaggctgggatgccaaactgctctggctgcctgcctcctaccttccagccggc
ctggtggatgctgtgttcacctgggtccttcccaagcctgcccaatcaatctactga

DBGET integrated database retrieval system