KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103739412Help
Entry
103739412         CDS       T03372                                 

Gene name
Ltb4r
Definition
(RefSeq) leukotriene B4 receptor
  KO
K04296  leukotriene B4 receptor 1
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103739412 (Ltb4r)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ngi04030]
    103739412 (Ltb4r)
G protein-coupled receptors [BR:ngi04030]
 Rhodopsin family
  Lipid
   Leukotriene
    103739412 (Ltb4r)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srv
Motif
Other DBs
NCBI-GeneID: 103739412
NCBI-ProteinID: XP_008838020
Position
Un
AA seq 284 aa AA seqDB search
MATNTTSPAASSSAAQGSWSFKVTGCRMCHYVCGVSMYASVLLITVMSLDRSLAVARPFL
SQKVRTKAIARWVLVGIWVVSFLLATPVLLYRTVSLLPNKTTLVCYSKYPSEGHRAFHLL
FEAITGFLLPFLAVVASYSDIGRRLQARRFRRSRRTGRLVVLIILAFAAFWLPYHFVNLA
EAGRALAGLGQNDPAGQRLKLARYVLIALAFLSSSVNPVLYACAGGGLLRSAGVGFVAKM
LEATGSEGSSSRRRGTLGQTARVPDATQEPSPTESIMTSSNPLA
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggctaccaacactacatctcctgcagcatcttcctctgccgctcaaggctcctggagt
tttaaagtgactggctgccgcatgtgtcactatgtctgtggtgtcagcatgtatgccagt
gtcctgctgatcacagtcatgagtctggaccgctcactggcagtagcccgcccctttttg
tcccagaaggtgcgcaccaaggcgattgcccggtgggtgctggtgggcatctgggtggtg
tcttttctgctggccacaccggtcctcttgtaccgcacagtaagtctgctaccgaacaag
acgactctggtctgctattccaagtaccccagtgaagggcacagggccttccacctgctc
ttcgaagccatcacgggcttcctgctgcccttcctggcggtggtggccagctactctgac
atcgggcgcaggctgcaggctcggcgcttccgccgcagtcgccgcaccggccgcctcgtg
gtgctcatcatcctggccttcgccgccttctggctgccctaccacttcgtgaacctggcg
gaggccggccgagcgctggcgggcttgggccagaacgaccctgccgggcagcggctgaag
ctggcccgctacgtgctcatcgcgctcgccttcctgagcagcagcgtgaacccggtgctg
tacgcatgcgcgggcggcggcctgctgcgctcagcgggcgtgggcttcgtagccaagatg
ctggaggccaccggctccgaggggtccagcagccgccgcaggggcaccctgggccagacg
gctagggtcccggatgccactcaggagccaagtcccaccgagagcatcatgacttcctcc
aaccctcttgcgtga

DBGET integrated database retrieval system