KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103739611Help
Entry
103739611         CDS       T03372                                 

Gene name
Zdhhc22
Definition
(RefSeq) zinc finger DHHC-type containing 22
  KO
K18932  palmitoyltransferase [EC:2.3.1.225]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    103739611 (Zdhhc22)
Enzymes [BR:ngi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     103739611 (Zdhhc22)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC
Motif
Other DBs
NCBI-GeneID: 103739611
NCBI-ProteinID: XP_008838249
Position
Un
AA seq 285 aa AA seqDB search
MLALRLLNVVAPAYFLCISLVTFVLQLFLFLPSMREDTAATQLFSPALLHGALFLFLSAN
ALGNYILVIQNSPDDLGASQGTTSRRAQCPPPSTHFCRVCARVTLRHDHHCFFTGNCIGS
RNMRNFVLFCLYTSLACLYSMVAGVAYISAVLSISFAHPLAFLTLLPTSISQFFSAERAL
LCTWPGCKVVWCFPSPAGAVLGSEMFVILMLYLWFAVGLACAGFCCHQLLLILRGQTRHQ
VRKGMAVRARPWRKNLQEVFGKRWLLGLLVPMFNVGSESSKQQDK
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgctggccctgcggctgctcaacgtggtggcccccgcctacttcctgtgcatttccctg
gtgaccttcgtgctccagctcttcctcttcctgcccagcatgcgtgaggacacggctgcc
actcagctcttctctcctgccctgcttcacggggccctcttcctgtttctctcagccaat
gccctgggcaattacatcctggtcatccagaactctccggatgacctgggtgcctcccag
gggaccacatcccgaagagctcagtgcccgccacccagcacccacttctgccgagtgtgc
gctcgagtcacactgaggcacgaccatcactgtttcttcactggtaactgcatcggcagc
aggaacatgcgcaacttcgtcctgttctgcctctatacctcgctggcctgcctctactcc
atggtggccggcgtggcctacatctcagctgtcctttctatttctttcgctcaccctttg
gccttcctcacgctcctgcccacgtcaatcagccagttcttctccgcggaaagagcgctc
ctgtgtacgtggcctgggtgtaaagtggtctggtgtttcccctcccccgcaggagctgtc
ctcggttctgaaatgttcgtcatcctcatgctctacctctggtttgccgtcggcctggcc
tgcgctggcttctgctgccaccagctgctgttgatcctccgggggcagacccgccaccag
gttcgaaagggaatggcagtgagggcccggccctggcgtaaaaacttacaggaagtcttc
ggaaagaggtggctattgggcctgctggtccccatgttcaatgtcgggagcgagagctca
aagcagcaggacaagtag

DBGET integrated database retrieval system