KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103740147
Entry
103740147         CDS       T03372                                 

Gene name
Cd40lg
Definition
(RefSeq) CD40 ligand
  KO
K03161  tumor necrosis factor ligand superfamily member 5
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04064  NF-kappa B signaling pathway
ngi04514  Cell adhesion molecules
ngi04660  T cell receptor signaling pathway
ngi04672  Intestinal immune network for IgA production
ngi05144  Malaria
ngi05145  Toxoplasmosis
ngi05310  Asthma
ngi05320  Autoimmune thyroid disease
ngi05322  Systemic lupus erythematosus
ngi05330  Allograft rejection
ngi05340  Primary immunodeficiency
ngi05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    103740147 (Cd40lg)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103740147 (Cd40lg)
   04514 Cell adhesion molecules
    103740147 (Cd40lg)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    103740147 (Cd40lg)
   04672 Intestinal immune network for IgA production
    103740147 (Cd40lg)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    103740147 (Cd40lg)
   05322 Systemic lupus erythematosus
    103740147 (Cd40lg)
   05320 Autoimmune thyroid disease
    103740147 (Cd40lg)
   05330 Allograft rejection
    103740147 (Cd40lg)
   05340 Primary immunodeficiency
    103740147 (Cd40lg)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    103740147 (Cd40lg)
  09174 Infectious disease: parasitic
   05144 Malaria
    103740147 (Cd40lg)
   05145 Toxoplasmosis
    103740147 (Cd40lg)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103740147 (Cd40lg)
   04090 CD molecules [BR:ngi04090]
    103740147 (Cd40lg)
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  Tumor necrosis fators
   103740147 (Cd40lg)
CD molecules [BR:ngi04090]
 Proteins
  103740147 (Cd40lg)
SSDB
Motif
Pfam: TNF
Other DBs
NCBI-GeneID: 103740147
NCBI-ProteinID: XP_008838925
Position
Un
AA seq 259 aa
MIETYSQPSPRSVATGLPASMKIFMYLLTVFLITQMIGSVLFAVYLHRRLDKVEEEKSLH
EDFVFIKKLQRCNKGDSLSLLNCEEIKRQFEDLVKDKMLNKEEKKKENNFEMQKGDQEPQ
IAAHVVSEASSKSAVLQWTKKGYYTMSNNLVALENEKLLTIQRKGFYYVYTQVTFCSNRE
PSSQAPFIVSLCLKSTSGSERILLRAANSYSSSKRCGQQSIHLGGVFELQSGASVFVNVT
DASQVSHGIGFTSFGLLKL
NT seq 780 nt   +upstreamnt  +downstreamnt
atgatcgaaacatacagccagccttctcctcgatctgtggccactggactgcccgctagc
atgaagatttttatgtatttacttactgtttttcttatcacccagatgattgggtcagta
ctttttgctgtgtatcttcatagaaggttggataaggtagaagaagaaaaaagtcttcat
gaagattttgtcttcataaaaaagttacagagatgcaacaaaggagattctttatccttg
ctgaactgtgaggaaattaaaaggcaatttgaagatcttgtcaaggataaaatgctaaac
aaagaggagaagaagaaagaaaacaactttgaaatgcaaaaaggtgatcaggaacctcaa
attgcagcacatgtcgtaagtgaggccagtagtaaatcagctgttctacagtggaccaag
aaaggatattacaccatgagcaacaacttggtagccctcgaaaatgagaaactgctaacc
attcaaagaaaaggtttctactacgtctacacccaagtcaccttctgttctaaccgggaa
ccttcaagtcaagctccatttatagtcagcctctgcctgaagtccaccagtggatctgag
agaatcttactgagggcagcaaattcctatagttcctccaaacgttgtgggcaacagtcc
attcacttgggaggcgtatttgaattgcaatcaggcgcttctgtgtttgtcaacgtgact
gatgcaagccaagtgagccatggaatcggcttcacgtcttttggcttactcaaactctga

DBGET integrated database retrieval system