KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103740533Help
Entry
103740533         CDS       T03372                                 

Gene name
Abhd6
Definition
(RefSeq) abhydrolase domain containing 6
  KO
K13700  abhydrolase domain-containing protein 6 [EC:3.1.1.23]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04723  Retrograde endocannabinoid signaling
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    103740533 (Abhd6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ngi01002]
    103740533 (Abhd6)
Enzymes [BR:ngi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     103740533 (Abhd6)
Peptidases [BR:ngi01002]
 Serine Peptidases
  Family S33
   103740533 (Abhd6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Ndr DUF1057 FSH1 Lipase DLH BAAT_C Esterase Thioesterase
Motif
Other DBs
NCBI-GeneID: 103740533
NCBI-ProteinID: XP_008839399
Position
Un
AA seq 337 aa AA seqDB search
MDLDVVNMFVIAGSTLAIPILAFVASFLLWPSALIRIYYWYWRRTLGMQVRYVQHEDYQF
CYSFRGRPGHKPSILMLHGFSAHKDMWLSVVKFLPKNLHLVCVDMPGHEGTTRSSLDDLS
IDGQVKRIHQFVECLKLNKKPFHLIGTSMGGHVAGVYAAYYPSDVCSLCLVCPAGLQYST
DNQFVQRLKELQESAAIQKIPLIPSTPEEMSEMLQLCSYVRFKVPQQILQGLVDVRIPHN
NFYRKLFLEIVSEKSRYSLHQNMDKIKVPTQIIWGKQDQVLDVSGADILAKSIATCQVEL
LENCGHSVVMERPRKTAKLILDFLASVHNTDNSKKLN
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atggatctggatgtggttaacatgtttgtgattgccggcagcaccctggccattccaatc
ctggcattcgtcgcctcttttctcctgtggccatcggcgctaataagaatctactactgg
tactggcggaggacactgggcatgcaagtccgctatgtgcagcacgaggactatcagttc
tgttactccttccggggcaggccagggcacaagccgtccatcctcatgctccatggattc
tcagcacacaaggatatgtggctcagcgtggtcaagttccttccaaagaacctgcactta
gtctgtgtggacatgccaggccatgaaggcaccactcgatcttccctggatgacctgtcc
atagatgggcaagtcaaaaggatccatcagtttgtagaatgccttaagctgaacaaaaag
cccttccaccttataggcacctccatgggaggccatgtggctggcgtctatgctgcttat
tacccatcagatgtctgcagcctgtgtctggtgtgccctgctggcctgcagtattcaact
gataaccagtttgtacaacggctcaaagagctgcaggagtccgccgccatacagaaaatt
cccttgatcccatctaccccagaagagatgagtgaaatgctccagctctgttcctatgtc
cgtttcaaggtgccccaacagatcctgcaaggccttgtcgacgtccgcatccctcataac
aacttctatcggaaactatttttggaaattgtcagcgagaagtccagatactctctacat
cagaacatggacaagatcaaggtcccgacacagatcatttgggggaaacaagaccaggtg
cttgatgtgtctggggcagatatattggccaagtcaattgctacctgtcaggtagagctt
ctggaaaactgtgggcactcggtggtgatggagagaccacgaaagacagccaagctcatc
cttgactttttagcatctgtgcacaacacagacaacagtaagaagctgaactga

DBGET integrated database retrieval system