KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103740721Help
Entry
103740721         CDS       T03372                                 

Gene name
Ddx18
Definition
(RefSeq) DEAD-box helicase 18
  KO
K13179  ATP-dependent RNA helicase DDX18/HAS1 [EC:3.6.4.13]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ngi03041]
    103740721 (Ddx18)
   03009 Ribosome biogenesis [BR:ngi03009]
    103740721 (Ddx18)
Enzymes [BR:ngi01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     103740721 (Ddx18)
Spliceosome [BR:ngi03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA helicase-like proteins
    103740721 (Ddx18)
Ribosome biogenesis [BR:ngi03009]
 Eukaryotic type
  90S particles
   Helicases
    103740721 (Ddx18)
  Pre-60S particles
    103740721 (Ddx18)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DEAD Helicase_C DUF4217 ResIII
Motif
Other DBs
NCBI-GeneID: 103740721
NCBI-ProteinID: XP_008839636
Position
Un
AA seq 661 aa AA seqDB search
MSHLQMKLLRRKIEKRNLKLRQRNLKLQEASDVKLPRPQNGDVPEETTKVGKVKTLKHSM
SVISSEAQNGDVSEETVENAKVKKFSPKSNPLTNGNAAATQSPNSELKKKKKKKRKMAAR
DVGPDTKKAKPEESPEAPEEMEDGVEKPDDEDSEVPSLPLGLTGAFEDTSFASLSNLVNE
NTLKAIKEMGFTNMTEIQHKSIRPLLEGRDLLAAAKTGSGKTLAFLIPVIELIVKLKFMP
RNGTGVLILSPTRELAMQTFGVLKELMTHHVHTYGLIMGGSNRSAEAQKLANGINIIVAT
PGRLLDHMQNTPGFMYKNLQCLVIDEADRILDVGFEEELKQIIKLLPIRRQTMLFSATQT
RKVEDLARISLKKEPLYVGVDDDKEVATVDGLEQGYVVCPSEKRFLLLFTFLKKNRKKKL
MVFFSSCMSVKYHYELLNYIDLPVLAIHGKQKQNKRTTTFFQFCNADSGILLCTDVAARG
LDIPEVDWIVQYDPPDDPKEYIHRVGRTARGLNGRGHALLILRPEELGFLRYLKQSKVPL
SQFDFSWSKISDIQSQLEKLIEKNYFLHKSAQEAYKSYIRAYDSHSLKQIFDVNNLNLPQ
VALSFGFKVPPFVDLNVSSEGRHKKRGGGGGFGYQKTKKVEKSKIFKHISRKPADRRQFS
H
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcacctgcagatgaaacttctgcggaggaagatcgagaagcggaatctcaagctg
cggcagcggaacctcaagctacaggaagcatcagatgtgaaactgccacggcctcaaaat
ggagatgtgcctgaagaaacaacaaaagttggaaaagttaaaaccctgaaacattccatg
agtgtcatctcatcagaagcacagaatggagatgtgtctgaagagacagtggaaaatgct
aaagttaaaaaattctcccccaaatctaatccattaaccaatggaaacgcagcagcaaca
cagtctcctaattcagaactgaaaaagaaaaagaagaaaaaaagaaaaatggcagcaaga
gatgtggggcctgatactaaaaaagcaaaacctgaagaaagccctgaggctcccgaggaa
atggaagatggtgtggagaagccagatgatgaggacagtgaggtgcccagcctgccccta
ggactgacaggtgcttttgaggacacttcatttgcttccctgtctaaccttgtcaatgaa
aacactctgaaggctataaaggaaatgggcttcacaaacatgactgaaatccaacataaa
agtatcaggccacttctggaaggcagggatcttctagcagcagcaaaaacaggcagtggc
aaaaccctggcttttctcattcctgtgattgagctcatcgttaagctaaagttcatgccc
aggaatggaacaggagtcctgattctttctcctacccgagaactggccatgcagaccttc
ggtgtccttaaggagttgatgacacaccatgtgcacacatatgggctgatcatgggtggc
agtaacaggtctgctgaagcacagaagctggcaaatggaatcaacatcatcgtggccacc
ccaggccggctcctggaccacatgcagaataccccagggtttatgtataaaaacctccag
tgtctggttatcgatgaagctgatcgtatcttggatgttgggtttgaagaggaattaaaa
caaattattaaactcttgccaatacgcagacagaccatgctcttttctgccacacaaact
cggaaagttgaagacttggcaaggatttctctgaaaaaggagccattgtatgtgggtgtt
gatgatgataaagaggttgccaccgtggatggtcttgagcaggggtatgttgtttgtccc
tctgaaaagagattccttctactcttcacgttcctgaagaagaaccgaaagaagaagctg
atggtcttcttttcatcctgcatgtcggtgaaataccactatgagttgttgaactacatt
gacttgcctgtcttggccatccatggaaagcagaagcaaaataagcgaacaaccacgttc
ttccagttctgcaatgcagattcagggatactgttgtgtacagatgttgccgcaagaggg
ctggacatccctgaagtggactggattgttcagtatgatcctccagatgaccctaaggaa
tatattcatcgggtgggtagaacggccagaggcctgaatggaaggggacacgccttgcta
attctgcgtcctgaagagttgggtttccttcgttacttgaagcaatccaaggtcccattg
agtcagtttgacttttcctggtcaaaaatttctgacattcagtctcagcttgaaaaactg
attgaaaagaactactttcttcataagtcagcgcaggaagcatacaagtcatacatacgg
gcctatgactcccattccctgaagcagatctttgatgtgaacaacttaaatttgcctcag
gttgctctgtcatttggtttcaaggtcccacctttcgttgatttgaatgtgagcagtgaa
ggcaggcataaaaagagaggaggtggtggtggatttggctaccagaagacgaagaaagtg
gagaagtccaagatctttaaacacatcagcaggaagccggcagaccgcaggcagttctct
cactga

DBGET integrated database retrieval system