KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103742812
Entry
103742812         CDS       T03372                                 

Gene name
Adamts13
Definition
(RefSeq) ADAM metallopeptidase with thrombospondin type 1 motif 13
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ngi01002]
    103742812 (Adamts13)
Enzymes [BR:ngi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     103742812 (Adamts13)
Peptidases and inhibitors [BR:ngi01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   103742812 (Adamts13)
SSDB
Motif
Pfam: TSP1_ADAMTS ADAM_CR_2 TSP_1 Reprolysin Reprolysin_4 Reprolysin_3 Reprolysin_5 TSP1_spondin ADAM_spacer1 Peptidase_M10 Reprolysin_2 TSP1_CCN
Other DBs
NCBI-GeneID: 103742812
NCBI-ProteinID: XP_008842131
Position
Un
AA seq 1423 aa
MSQLHPWVTCHPSHVVSVRGVLTGAFFILGCWGLSDFQQSFLQALEPKEVSSHLGPDAAV
PIGHSSSHLKRLRWGRAVEDILHLELLVAAGPDVYQAHQEDTERYVLTNLNIGSELLRDP
SLGAQFRVHLVKLIILTEPKGAPDITANITSSLISVCEWSQAINPADDRDPGHADLILYI
TRFDLELPDGNRQVRGVTQLGGACSPSWSCLITEDTGFDLGVTIAHEIGHSFGLDHDGAP
GSGHACETSGHVMASDGAAPARWALGWSICSQRRLQHLLSTGRMHCMWDPPGLQSGPMQH
QLLAKPGLYYSADDQCRIAFGSGVAACTFSREGLDVCQALSCHTDPLDQSSCSRLLVPLL
EGTECGVEKWCSKGRCRSLAELTPVAAVHGHWSSWGPQSPCSRSCGGGVVTRRRWCNNPR
PAFGGRACVGADLQAEMCNTQACEKTQLEFMSEQCAQTDSQPLHLSQGSSFYRWSAAVQY
SQGDTLCRHMCWAVGESFIVRRADSFLDGTRCVPNGPREDGTLSLCVSGNCRTFGCDGRM
DSQQVWDACQVCGGDNSTCSSQNDSFKAGRAREYVTFLTVTPNMTNVHVVNRRPLFTHLA
VRLQGRYVVAGKTSISPSTTYPSVLEDHRVEYRVTLTGDRLPHLEEVHIRGPIQEDMEIQ
VYRRYGEEYGDLTRPDIIFTYFQLKQQAAWVWAAMRGPCSVSCGAGLRWVTYSCLDQAQN
KFMETAQCQGSPQPPAWPEPCVLAPCPPYWTAGDFGPCSLSCGGGLRERLVHCMEAQDGS
LRMLPPARCSAVAQQPEAEVEVCNPQPCPDRWEVSDPSLCLSACGTDLALRNVTCVSGAG
GLEMSATSGPCPTNETTAALKPCFRKVCPPGWGQVDSTSPEEEVLSSPVGSPKSEAQAQH
MWVPLVGLCSVSCGQGRMEMNFLCVDSVLRTPVQEELCASRKPLRRWEVCRAGPCPARWE
AQVLALCPMTCGGGWVPLAICCVQQDRGHPVSXPHSKCWPVPQPGPFKDCNTEPCPAQWK
VLSLGPCSASCGLGTATRTVACMQLDGGQDWEVEEALCAALVRPQASVPCLIADCAYRWH
VSTWTECSVSCGDGIQRRHDTCLGPQAHVPMPDNFCRHLPKPVTVRGCWAGPCAGPRTSS
LARHNEAMPAGQTLAALAAASQERPQPRGRAQPLFPSFQPLGPQENLSESGACGRQYLEP
TGTIVMRSQEKADCVVAIRRPLGEVVTLQILESSLKCNAGELLLLXGRLTWRKTCHRLSG
MTFSTKTNTLVVRQHXVLPGGGVMLRYXSWPAPGTFHRACDRHVFGPRGQIMSPSQSPDR
RDAGSCCVFIIVAPQXRIAIHALVTDMGTASEGTNASYVLIRDIHSLRTTAFRGQRXLYW
ESDGSEAEVEFSPGFLEAPANLQGQSWTLPPKTLEEDAGLVLP
NT seq 4272 nt   +upstreamnt  +downstreamnt
atgagccagcttcacccctgggtaacatgccacccttcccatgtggtcagtgtcagagga
gtcctcactggtgccttcttcatcctgggatgctgggggctctccgatttccagcagagt
tttcttcaggctctggaacccaaggaggtatcatctcatcttggccctgatgctgctgtg
cccataggtcactcttcctctcacctcaagagactgagatggggaagggctgtggaggac
attctgcacctggagctgctggtggctgcgggccccgatgtctatcaggctcatcaggaa
gacacagagcgctacgtgctgaccaacctcaatatcgggtcagaactgctgagggaccca
tccctgggggctcagttcagagtgcacctggtgaagttgatcattctcaccgagcccaag
ggtgctccagatatcacagccaacatcacctcgtctctgataagtgtctgtgaatggagc
caggcaatcaaccccgccgacgacagggatcctgggcatgctgacctaatcctctatata
accaggtttgacctggagttgcctgatggtaaccggcaggttcggggggtcacccagctt
gggggtgcctgctccccttcctggagctgtctcatcaccgaggacactggctttgatctg
ggggtcaccattgcccatgagattgggcacagctttggcctggatcatgatggagctcca
ggcagtggccacgcctgtgagaccagtggccatgtgatggcatctgatggtgcagcacct
gctagatgggccctggggtggtccatctgtagccagaggcggctgcagcacctactcagc
acagggcgaatgcactgcatgtgggacccaccggggctgcagtctggacccatgcagcac
cagctgcttgcaaagcccggcctttactacagtgcggatgatcaatgtcgcatcgctttt
ggctccggggttgctgcttgcaccttctccagggagggtctggatgtgtgccaggccctc
tcctgtcacacagatcccctggaccaaagcagctgtagccgcctcctcgttcctcttctg
gagggaacagaatgtggtgtggagaagtggtgttccaagggtcgctgccgctccctggca
gagttgacccccgtggcagcagtacatggacactggtctagctggggcccccagagtcct
tgctcccgctcctgtggaggaggtgtggttaccaggaggcggtggtgcaataaccccaga
cctgcctttggggggcgtgcgtgtgtgggtgctgacctccaggcagagatgtgcaacact
caggcttgtgagaagactcagctggagttcatgtcggagcagtgtgcccagaccgacagc
cagccactgcacctctcccagggcagctccttctaccgctggagtgccgctgtgcagtat
agtcaaggggacactctgtgcagacacatgtgctgggctgttggagaaagcttcatcgtg
agacgtgcagacagtttcctggatgggacccggtgtgtgccgaatggccctcgggaggat
ggtaccctgagtttgtgtgtgtccggcaactgcaggacgtttggctgtgatggcaggatg
gattcccagcaggtttgggatgcgtgccaggtgtgcggaggagacaacagcacttgcagt
tcacagaatgactctttcaaggctggaagagccagagagtatgtcacgttcctgacagtt
actcccaacatgaccaatgtgcacgtcgtcaaccgaaggcctcttttcacacacttggcg
gtgaggctccagggccgctatgttgtggcagggaagaccagcatctcccccagcactacc
tacccatccgtcctggaggaccaccgagtggaatacagagtgactctcactggggaccgg
ctgccccacctagaggaggtccacatccggggacccatccaggaagacatggagatccag
gtgtacaggagatatggagaggagtatggggacctcacgcgcccagacatcatcttcacc
tacttccagctgaagcaacaggcagcctgggtgtgggccgccatgcgcgggccctgctcg
gtgagctgtggggcagggctgcgctgggtgacctacagctgcctggatcaagcccagaac
aagttcatggagactgctcagtgccaagggagcccgcagccacctgcatggccagagccc
tgtgtccttgcaccctgtcccccatactggacagctggagacttcggcccttgcagcctg
tcctgtgggggagggcttcgggagcggctggtgcactgcatggaggcccaggacggctcc
ttaaggatgctaccaccagccaggtgcagtgcagtagcccagcagccagaggcagaggtg
gaagtttgcaacccccagccctgtcctgacagatgggaggtgtcagaccccagcctttgc
ttgtcggcctgtggaacagatctggccttgaggaatgtgacatgtgtgtctggggctggt
ggccttgagatgtcagcgacttcagggccctgccccacaaatgagacaacagctgccctg
aagccctgtttcaggaaagtgtgccctccaggctggggtcaggtagacagcacatctccc
gaagaggaagttctgtcgtccccagtcggcagtcccaagtcagaggctcaggctcaacat
atgtgggttcctttggtggggctatgctccgtatcctgtgggcaaggccggatggagatg
aacttcctgtgcgtggattctgtcctcaggacgccggtccaggaagagctgtgtgcttcc
aggaagccgttgcgccggtgggaggtctgcagggcaggcccatgccctgctcgatgggaa
gcccaagtcttggcactgtgcccaatgacctgtggaggagggtgggtgccactagctatt
tgctgtgtgcaacaggaccgtggccatcctgtctctnnacctcattccaagtgctggccg
gtgcctcagcctgggccctttaaggactgcaacactgagccctgccctgctcagtggaaa
gtcctgtctcttggtccatgctcggccagctgtggccttggcactgccacacgcacagtg
gcctgtatgcagcttgatggaggccaggactgggaggtggaggaggccttgtgtgcagct
ctggtgaggcctcaggccagcgtcccctgcctcatcgctgactgtgcctaccggtggcat
gtcagcacctggacagaatgctctgtctcctgcggggatggcattcagcgccgacatgac
acctgccttggaccccaggcccatgtgcccatgccagacaacttctgtcggcacctgccc
aagccagtgacagtgcggggctgctgggccggaccctgtgcagggccgaggacctccagc
ctggcacgccacaacgaagccatgcctgcaggccagaccctggctgctctggctgcagct
tctcaggaacggccccagcccagaggccgggcccaacctctcttcccatccttccagcct
ttggggccccaggaaaacctgtcggagtctggtgcctgtggcaggcagtacctggagccc
acaggaaccattgtcatgcgaagtcaggagaaggcagactgtgtggtggccatcaggcgg
cccctgggtgaggtggtgaccctccagatccttgagagctccctcaagtgcaacgcaggg
gagctgttgctgctatagggtaggctcacatggaggaagacatgccacaggctgtctggc
atgactttcagcaccaagaccaacacactggtggtgcggcagcactgagtgctcccaggg
ggtggagtgatgttgcggtacntgagctggcctgccccggggaccttccacagagcatgt
gacaggcacgtctttggaccccggggtcaaatcatgagtccctcacaaagcccagacagg
agggatgcagggagctgctgtgtcttcatcattgtggccccacagncccgcattgccatc
catgccctggtcactgacatgggcactgcaagtgaggggaccaatgccagctatgtcttg
atccgggatatccacagcctgaggaccacagcatttcgagggcagcggncactctactgg
gagtcggatggcagcgaggctgaggtggagtttagtcccggcttcctggaggcaccggcg
aacctacagggccagtcctggacccttccaccgaagacactggaagaggacgccggcctg
gtcctgccctag

DBGET integrated database retrieval system