KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103743312Help
Entry
103743312         CDS       T03372                                 

Gene name
Insr
Definition
(RefSeq) insulin receptor
  KO
K04527  insulin receptor [EC:2.7.10.1]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04010  MAPK signaling pathway
ngi04014  Ras signaling pathway
ngi04015  Rap1 signaling pathway
ngi04022  cGMP-PKG signaling pathway
ngi04066  HIF-1 signaling pathway
ngi04068  FoxO signaling pathway
ngi04072  Phospholipase D signaling pathway
ngi04150  mTOR signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04152  AMPK signaling pathway
ngi04211  Longevity regulating pathway
ngi04213  Longevity regulating pathway - multiple species
ngi04520  Adherens junction
ngi04910  Insulin signaling pathway
ngi04913  Ovarian steroidogenesis
ngi04923  Regulation of lipolysis in adipocytes
ngi04930  Type II diabetes mellitus
ngi04931  Insulin resistance
ngi04932  Non-alcoholic fatty liver disease (NAFLD)
ngi04960  Aldosterone-regulated sodium reabsorption
Module
ngi_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    103743312 (Insr)
   04015 Rap1 signaling pathway
    103743312 (Insr)
   04010 MAPK signaling pathway
    103743312 (Insr)
   04066 HIF-1 signaling pathway
    103743312 (Insr)
   04068 FoxO signaling pathway
    103743312 (Insr)
   04072 Phospholipase D signaling pathway
    103743312 (Insr)
   04022 cGMP - PKG signaling pathway
    103743312 (Insr)
   04151 PI3K-Akt signaling pathway
    103743312 (Insr)
   04152 AMPK signaling pathway
    103743312 (Insr)
   04150 mTOR signaling pathway
    103743312 (Insr)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    103743312 (Insr)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103743312 (Insr)
   04923 Regulation of lipolysis in adipocyte
    103743312 (Insr)
   04913 Ovarian Steroidogenesis
    103743312 (Insr)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    103743312 (Insr)
  09149 Aging
   04211 Longevity regulating pathway - mammal
    103743312 (Insr)
   04213 Longevity regulating pathway - multiple species
    103743312 (Insr)
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    103743312 (Insr)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    103743312 (Insr)
   04931 Insulin resistance
    103743312 (Insr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ngi01001]
    103743312 (Insr)
  09183 Protein families: signaling and cellular processes
   04090 CD Molecules [BR:ngi04090]
    103743312 (Insr)
Enzymes [BR:ngi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     103743312 (Insr)
Protein kinases [BR:ngi01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   103743312 (Insr)
CD molecules [BR:ngi04090]
 Proteins
  103743312 (Insr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Recep_L_domain Pkinase Furin-like fn3 Kinase-like DUF4476 B2
Motif
Other DBs
NCBI-GeneID: 103743312
NCBI-ProteinID: XP_017656482
Position
Un
AA seq 1382 aa AA seqDB search
MGAGARRGATAAPLLVAVAALLVGAAGHLYPGEVCPGMDIRNNLTRLQELENCSVIEGHL
QILLMFKTRPEDFRDLSFPKLIMITDYLLLFRVYGLESLKDLFPNLTVIRGSRLFFNYAL
VIFEMVHLKELGLYNLMNITRGSVRIEKNNELCYLATIDWSRILDSVEDNYIVLNKDDNE
ECGDVCPGTAKGKTNCPATVINGQFVERCWTHSHCQKVCPTICKSHGCTAEGLCCHTECL
GNCSEPDDPTKCVACRNFYLEGRCVETCPPPFYHFQDWRCVNFSFCQDLHYKCKNSRKPG
CHQYVIHNNKCIPECPSGYTMNSSNLMCTPCLGPCPKVCQILEGEKTIDSVTSAQELRGC
TVVNGSLIINIRGGNNLAAELEANLGLIEEISGFLKIRRSYALVSLSFFRKLRLIRGETL
EIGNYSFYALDNQNLRQLWDWSKHNLTITQGKLFFHYNPKLCLSEIHKMEEVSGTKGRQE
RNDIALKTNGDQASCENELLKFSFIRTSFDKILLKWEPYWPPDFRDLLGFMLFYKEAPYQ
NVTEFDGQDACGSNSWTVVDIDPPQRSNDPKSQNHPGWLMRGLKPWTQYAIFVKTLVTFS
DERRTYGAKSDIIYVQTDATNPSVPLDPISVSNSSSQIILKWKPPSDPNGNITHYLVYWE
RQAEDSELFELDYCLKGLKLPSRTWSPPFESDDSQKHNQSEYDDAAGECCSCPKTDSQIL
KELEESSFRKTFEDYLHNVVFVPRKTSSGTGAEDPRPSRKRRSLGEVGNVTAAMPTLPDF
PNISSTITPTSQEEHRPFEKVVNKESLVISGLRHFTGYRIELQACNQDSPEERCSVAAYV
SARTMPEAKADDIVGPVTHEIFENNVVHLMWQEPREPNGLIVLYEVSYRRYGDEELHMCV
SRKHFALERGCRLRGLSPGNYSVRIRATSLAGNGSWTEPTYFYVTDYLDVPSNIAKIIIG
PLIFVFLFSVVIGSIYLFLRKRQPDGPMGPLYASSNPEYLSASDVFPCSVYVPDEWEVPR
EKITLLRELGQGSFGMVYEGNAKDIIKGEAETRVAVKTVNEAASLRERIEFLNEASVMKG
FTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSHLRSLRPESENNPGRPPPTLQEMIQMA
AEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPV
RWMAPESLKDGVFTASSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDPPDN
CADRLTDLMRMCWQFNPKMRPTFLEIVSLLKDDLHPSFPEVSFFHSEENKAPENEELEME
FEDMENVPLDRSSRCQREEAGGREGGSSLSIKRNYEDHIPYTHMNGGKRNGRILTLPRSN
PS
NT seq 4149 nt NT seq  +upstreamnt  +downstreamnt
atgggcgctggggcaaggcggggggccacggccgcaccgctgctggtggcggtggccgcg
ttgctggtgggtgcagccggccacctgtatcctggagaggtgtgtcccggcatggatatt
cggaacaacctcaccaggctgcaggaactggagaactgctcggtcattgagggccatctg
cagattctcctcatgttcaaaacgagacccgaagatttccgcgacctcagtttccccaag
ctcatcatgatcactgactatctgctgctcttccgggtctacgggctggaaagcctgaaa
gacctcttccctaacctcacggtcatccgtggctcccgcctctttttcaactacgcccta
gttatctttgagatggtgcacttgaaggagctggggctctacaacctcatgaatatcacc
cggggctctgtccgcatcgagaagaataacgagctctgctacttggccaccatcgactgg
tcccggatcctggattctgtggaagacaactacatcgttctgaacaaagatgataatgag
gagtgcggggacgtctgtcctggcaccgcgaagggcaagaccaactgccctgccaccgtc
atcaacgggcagttcgtggaacgttgctggacacatagccattgtcagaaagtgtgccca
accatctgtaaatcacatggctgcacagcggaaggcctgtgctgccacacggaatgcctg
ggcaactgttctgagcctgatgaccccaccaagtgcgtggcctgtcgcaatttctacttg
gaaggtcggtgtgtggagacctgtccgccccccttctaccacttccaggactggcgctgt
gtgaacttcagcttttgccaagacctgcactacaaatgcaagaactcaaggaagccaggc
tgccaccaatacgtcattcacaataacaagtgcatccctgagtgtccttctggctacacc
atgaactccagcaacttgatgtgcaccccgtgtctgggaccatgtcctaaggtctgtcaa
atccttgaaggcgagaagaccatcgattcagtaacatctgctcaggagcttcgaggctgc
actgtggtcaatggcagcctgatcatcaacattcgagggggcaacaacttggcagctgaa
ctggaggctaaccttggcctcatcgaagaaatttcagggttcctaaagatccgccgatcg
tatgctctggtatcactttctttcttccgaaagctacgtctgattcgaggagagaccttg
gaaattgggaactactctttctatgccttggacaaccagaacctgcggcagctgtgggac
tggagcaaacacaatctcaccatcactcagggcaagctcttcttccactacaatcccaag
ctctgcttgtctgaaattcacaagatggaggaagtttccggaaccaagggtcgccaggag
agaaacgacattgccctgaagaccaatggggatcaggcatcctgtgaaaatgaattgctt
aaattttctttcattcgaacatcttttgacaagatcttgctgaaatgggagccctactgg
ccccccgacttccgggacctcttgggattcatgcttttctacaaagaggccccttatcag
aatgtgacagagtttgatgggcaggatgcatgtggttccaacagctggaccgtggtagat
attgacccaccccagaggtccaatgatcccaagtcccagaaccaccctgggtggctgatg
cggggcctcaagccctggacccagtatgctatctttgtcaagaccttggtgaccttctct
gatgaacgccggacctatggggccaagagtgacatcatctatgttcagacagatgccacc
aatccttccgttcccctggatcccatatcagtttctaattcctcatcccagattatcttg
aaatggaagcccccatcagaccccaatggcaacatcactcactatttggtatactgggag
aggcaggcggaagacagtgagcttttcgagttggattattgtctcaaagggctgaagctc
ccctcaaggacctggtccccaccttttgagtctgatgactcacagaagcacaatcagagt
gagtacgatgacgcagctggtgaatgctgctcgtgcccaaagaccgattcccagatcctg
aaggagctggaggagtcctcgtttaggaagacctttgaggattacctgcacaatgtggtt
tttgtccccagaaaaacctcttcaggcactggtgctgaggaccctaggccatcccggaaa
cgcagatcccttggagaagtggggaatgtgacggctgccatgcccactctcccagatttt
cctaacatctcttccaccatcacacctacgagccaggaggagcacaggccctttgaaaaa
gtggttaacaaggagtccctggttatctctggccttcggcacttcactggctaccgtatc
gagctgcaggcgtgtaaccaagactccccggaagagaggtgcagtgtggctgcctatgtc
agtgcccggaccatgcctgaagctaaggcagatgacattgttggccctgtgacccatgaa
atctttgagaacaatgttgtacacttgatgtggcaagagccaagggaacccaatggtttg
attgtgctgtatgaagtaagctatcggcggtatggtgatgaggagctacacatgtgtgtt
tctcggaagcattttgccctggaacggggctgcaggctgagagggctctcccctggaaac
tacagtgttcgaatccgggccacctctctggcgggcaatggctcctggacagaacccacc
tatttctacgtgacagattacttagatgtcccatcaaatattgccaaaattatcatcggc
ccactcatctttgtgttcctcttcagtgttgtgattggaagtatttatctattcctgaga
aagaggcagccggatgggccaatgggaccactgtatgcgtcttcaaacccagagtacctc
agtgccagtgatgtgtttccatgttctgtgtacgtaccggatgagtgggaagtgcctcga
gagaagatcaccctcctccgagagctggggcaaggctccttcggcatggtgtatgagggc
aatgccaaggacatcatcaagggcgaggcagagacccgtgtggctgtgaagacagtcaat
gaggcagccagcctccgagaaaggatcgagttcctcaacgaggcatccgtcatgaagggc
ttcacctgtcaccatgtggtccgcctccttggagtggtgtccaagggccagccgacactg
gtggtgatggagttgatggctcatggagacctgaagagccacctccgttctctgcgtcca
gagtctgagaataaccctggccgccctccccctaccctacaagagatgattcagatggca
gcagagattgctgatggcatggcgtacttgaatgccaagaagtttgtgcaccgagacctg
gcagctcgaaactgcatggttgcccatgatttcactgtcaaaattggagacttcggaatg
accagagacatctacgagacagattactaccggaaagggggcaaaggcctgctgcctgtg
cggtggatggcacccgagtccctgaaggatggagtctttactgcttcttctgacatgtgg
tcctttggggtggtcctttgggaaatcaccagcctggcggaacagccttatcaaggcctg
tctaatgagcaggtgttgaaatttgtcatggatggaggctatctggatccgccggataac
tgtgctgacagactcaccgacctgatgcgcatgtgctggcagttcaaccccaagatgcgg
ccgacattcctggagatcgtcagcctcctcaaggatgacctacaccccagctttccagaa
gtttccttcttccacagcgaggagaacaaggctcctgagaacgaagagctggagatggag
tttgaggacatggagaacgttccgttggatcggtcctctcgctgtcagagggaggaggct
gggggccgggagggagggtcctctctcagcatcaaacggaactatgaagaccacatcccc
tacacccacatgaacggaggcaagaggaatggacgcatcctcactttgcctagatcaaat
ccttcctaa

DBGET integrated database retrieval system