KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103744167
Entry
103744167         CDS       T03372                                 

Gene name
Aff3
Definition
(RefSeq) AF4/FMR2 family member 3
  KO
K15195  AF4/FMR2 family member 3
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ngi03021]
    103744167 (Aff3)
Transcription machinery [BR:ngi03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     103744167 (Aff3)
SSDB
Motif
Pfam: AF-4 AF-4_C AF4_int
Other DBs
NCBI-GeneID: 103744167
NCBI-ProteinID: XP_008844089
Position
Un
AA seq 1250 aa
MDSFDLALLQEWDLESLWGEDILSQRNDSLVVEFQSSASRCRSVYEPDRNALRRKERERR
NQETQQDGGTFNSSYSLFSEPYKTNKGDELSNRIQNTLGNYDEMKDFLTDRSNQSHLVGV
PKPGVPQTPVNKIDEHFVADSRAQTQPSSVCSTASSTSAAVPVQQSKRGTMGWQKAGHPP
SDSQQRAAQQGSLRTVLGDGVSRQQTRAKQVCNVEAGLQTQERPPAIAAKHNSSGHCVQN
FPPSLASKPSLVQQKPTAYVRPMDGQDQAPDESPKLKSSTETGVHCTPYRGVPANKPESA
RAKAKLAKFSIPKQGEESRSGESNSCVEDIIREMTWLPPLSAIQAPGKVEPSKFPFPNKD
SQLVSSGHNNPKKGDAEPESPDNGTSNTSMLEDDLKLSSDDEESEQQAAQRTALRALSDS
TVVQQTNCRGSVPSSKGSSSGSSSGSSSSSSDSESSSGSDSETESSSSESEGSKPPHYSS
PEAEPASSNKWQLDKWLNKVNPHKPPILIQNESHGPERNQYYTPVKDEGQDCGKLPDICP
ASLREKESKSACKEEQRPRTANKAPGSKGAKQKSPPAAVAXXXXXXAPPPAVTGAPTESA
PAPARRSAGKKPTRRTERTPAGDSATCHRPEEPAAADALGAGVAGPPEPAKTRPCSNSRT
SHRKDLRPSVPCEKRRTRGLSRIVPKSKEFIETESSSSSSSSDSDLESEQEEYALSKAQA
AAAAGNEQRLKEAANSISSSGAPRAPVGSINARTTSDIAKELEEQFYTLVPFGRNELLSP
LKDSDEVRSLWVKIDLTLLSRIPEHLPQEPGALSTPAAKDTESAPASHALDTPAEKTLPK
SKRKRKCDNEDDYREIKKAQGDKESSSRLPASTNNTLSGNHCNMNISSLAIPVNKNEKIL
RSPISPLSDASKHKYSSEDLTSSSRPHSNAVFTSASSNKKPKADSQLQSHAGDLTKAAHN
SSENGILHKSRPQTEPWSPGSNGHRDCKRQKLIFDDMPRSADYFMQEAKRMKHKADAMVE
KFGKALNYAEAALSFIECGNAMEQGPMESKSPYTMYSETVELIRYAMRLKTHSGPNATPE
DKQLAALCYRCLALLYWRMFRLKRDHAVKYSKALIDYFKNSSKAAQAPSPWGASGKSTGT
PSPMSPNPSPTSSVGSQSSLSSTNALSPSTIVSIPQRIHQMAANHVSITNSILHSYDYWE
MADNLAKENREFFNDLDLLMGPVTLHSSMEHLVQYSQQGLHWLRNSTHLS
NT seq 3753 nt   +upstreamnt  +downstreamnt
atggacagcttcgacttagccctgctccaggaatgggacctcgagtcgctgtggggtgaa
gacatcttaagccagaggaatgattctctagttgtggaatttcagtcatcagccagcaga
tgcaggagtgtctatgaaccagataggaatgcattacggaggaaagaacgagaaagaaga
aatcaggaaacgcaacaggatggtggcacttttaattccagttactctctcttcagtgaa
ccctataagactaacaagggggatgaactctccaaccggatccagaatactttaggcaat
tatgatgaaatgaaagactttttaaccgatagatccaatcagagtcatcttgttggcgtc
cccaaaccaggggttcctcagactcctgtgaacaagatcgatgaacattttgttgcagat
tcaagagcccagacccagccctcatctgtctgcagcactgcatcttccacatctgcagct
gtccctgtgcagcagagtaagagaggcaccatgggctggcagaaggctgggcacccaccc
tctgacagccaacagagagcagcacaacagggctctctcaggacggtgctgggagatggt
gttagcagacagcagacaagggccaagcaagtgtgcaatgtggaggcagggctccagacc
caggagaggccaccagccatagcagccaaacacaacagcagtggacactgtgttcagaac
ttccctccatccttggcttcaaaacccagtctggtccagcagaaaccaactgcatatgtg
cggccaatggatggccaagatcaggctcctgatgagtctcccaagcttaagtcatccaca
gaaactggtgtacactgcacaccctacagaggagtcccagccaacaagccagagtcagcc
agagccaaggccaagcttgccaagttcagcatccccaagcaaggagaggagagtagatct
ggagaaagcaacagctgtgttgaagacataatccgggagatgacctggctccctccactg
tctgctattcaagctcctggcaaagtagaaccaagcaaatttccatttccaaataaggac
tctcaacttgtatcctctggacacaataatccaaagaaaggtgatgcggagccagagagt
ccagacaatggtacatcgaatacatcaatgctagaagatgaccttaagctaagtagtgat
gacgaagagagtgaacagcaggcggcccagagaacggctctccgcgctctatctgacagc
accgtggtccagcagaccaactgcagaggttctgtgccgtccagcaagggcagcagcagc
ggcagcagcagcggcagcagcagctcctccagcgactccgagagcagctcgggttctgat
tcagagaccgagagcagctccagtgaaagcgagggcagcaagcctcctcactactccagc
cccgaggccgaaccagcgtcctctaacaaatggcagctggataaatggctaaacaaagtt
aatccgcacaagccacctattctgatccaaaatgaaagccatgggccagagaggaatcaa
tattacacccctgtgaaagatgaagggcaggactgcgggaaacttccggacatctgcccg
gccagcctgagagagaaggagagcaagagtgcctgcaaggaggagcagaggccgcggacg
gccaacaaggccccgggcagcaaaggggcgaagcagaagtccccgcccgcggccgtggcn
nnnnnnnnnnnnnnnnnngcccccccccccgccgtgaccggagcgcccaccgagagcgcg
cccgcgcccgcccggaggtcggccggcaagaagcccacccggcgcaccgagaggacccca
gccggggacagtgctacctgccaccgacccgaggagccggccgccgcggacgcgctaggg
gccggcgtggcagggcccccggagcccgccaaaaccaggccctgcagcaacagcaggacg
agccaccgcaaggacctgcgcccctcggtgccctgcgagaagcggcgtacgcgggggctg
agcaggatagtccccaaatccaaggagtttattgagacagagtcatcatcttcctcttct
tcctcagactcggacctggagtcagagcaggaagagtacgccctgtccaaggcgcaggct
gctgctgctgctgggaatgagcaacgtcttaaggaggctgccaacagcatcagcagtagt
ggagccccccgggcgcctgtgggctccatcaacgccaggaccaccagtgacatcgccaag
gagctagaggaacagttctacaccctggtgcccttcggccggaatgaacttctatcccca
ctgaaggacagcgatgaggtcaggtctctttgggtcaaaattgacctgaccctcctgtcc
aggatcccagaacacctgccccaggagcctggggccttgagcactcctgcagccaaggac
actgagagcgccccagccagccacgcattagacacacctgctgaaaagactttgccaaaa
tccaagaggaaacgcaagtgtgacaatgaagatgactacagggagataaagaaggctcag
ggagacaaggagagttcttcacgtctgcctgcctccactaataacaccttgtctgggaac
cactgcaacatgaacatcagtagcttggcaataccagtaaataaaaatgaaaaaatactc
cggtcacccatttcacccctctctgatgcatctaaacacaaatactccagtgaggacttg
acttcttccagccgacctcacagcaatgctgtgttcacttctgcctcctccaacaagaag
cctaaggctgacagccagctgcagtcccatgctggagacctcacgaaagcagctcataac
agttctgaaaatggtatcctccacaagtcacgaccacaaactgaaccatggtctccaggc
tccaatggccacagggactgcaagaggcaaaaactgatcttcgatgacatgccccgcagt
gcagattattttatgcaggaagctaaacggatgaagcataaagcagatgcaatggtggag
aagtttgggaaggccttgaactacgccgaagcagccttgtcgtttattgagtgtggaaat
gcaatggaacaaggcccgatggaatccaagtctccctacaccatgtactcagagacagtg
gagctcatcaggtatgctatgagactaaaaacccattcaggccccaacgccacaccagag
gacaaacagctagctgcattatgttaccgatgcctggctctcctatactggcgaatgttt
cgactcaaaagggaccacgctgtcaagtattcaaaggcacttatcgactatttcaagaat
tcatcaaaagctgcccaagccccatccccatggggggccagtggaaagagcactggaacc
ccatcccccatgtctcccaacccttctcccaccagctccgtggggtctcagagcagcctt
tccagcaccaatgccttgtccccatcgaccatcgtcagcatcccccagcgcattcaccag
atggcagccaatcacgtcagcatcaccaacagcatcctccacagctatgactactgggag
atggctgacaacctagccaaggaaaacagagagttcttcaatgatctggatttgctcatg
gggcctgtcaccctgcacagcagcatggaacacctggtccagtactcccagcagggcctg
cactggctgcggaacagcacccacctgtcctag

DBGET integrated database retrieval system