KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103744452Help
Entry
103744452         CDS       T03372                                 

Gene name
Idh1
Definition
(RefSeq) isocitrate dehydrogenase (NADP(+)) 1, cytosolic
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi00020  Citrate cycle (TCA cycle)
ngi00480  Glutathione metabolism
ngi01100  Metabolic pathways
ngi01200  Carbon metabolism
ngi01210  2-Oxocarboxylic acid metabolism
ngi01230  Biosynthesis of amino acids
ngi04146  Peroxisome
Module
ngi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ngi_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    103744452 (Idh1)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    103744452 (Idh1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    103744452 (Idh1)
Enzymes [BR:ngi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     103744452 (Idh1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 103744452
NCBI-ProteinID: XP_008844432
Position
Un
AA seq 414 aa AA seqDB search
MSKKIHGGSVVEMQGDEMTRIIWELIKEKLIFPYVELDLHSYDLGIENRDATNDQVTKDA
AEAIKKYNVGVKCATITPDEKRVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRL
VTGWVKPIIIGRHAYGDQYRATDFVVPGPGKVEITYTPSDGTQKVTYMVHNFGEGGGVAM
GMYNQDKSIEDFAHSSFQMALSKGWPLYLSTKNTILKKYDGRFKDIFQEIYDKQYKSQFE
AQKIWYEHRLIDDMVAQAMKSEGGFIWACKNYDGDVQSDSVAQGYGSLGMMTSVLICPDG
KTVEAEAAHGTVTRHYRMYQKGQETSTNPIASIFAWSRGLAHRAKLDNNAELSLFAKALE
EVCVETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKAKLAQAKL
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaaaaaatccatggcggttctgtggtagagatgcaaggagatgaaatgacacga
atcatttgggaactgattaaagaaaaactcatttttccctatgtggaattggatctgcat
agctatgacttaggcatagagaatcgagatgctaccaatgaccaggtcaccaaggatgcc
gcagaagctataaagaagtacaacgttggtgtcaagtgtgcgactatcacccccgatgag
aaaagggtagaggagttcaagttgaaacaaatgtggaagtcaccaaatggcaccatccga
aatattctgggtggcactgtcttcagggaagctattatctgcaaaaacatcccccggctg
gtgactggctgggtaaagcccatcatcattgggcgtcatgcctacggggaccaatacaga
gcaactgattttgttgttcctgggcctggaaaagtagagataacctacacaccaagtgat
ggaactcaaaaggtgacatatatggtgcataactttggagaaggtggcggtgttgctatg
ggcatgtacaatcaagataagtcaattgaagattttgcacacagttccttccaaatggct
ctgtccaagggctggcctttgtatctgagcaccaaaaacactattctgaagaagtatgat
gggcgtttcaaagacatctttcaggagatctatgacaagcagtacaaatcccaatttgaa
gctcagaagatctggtatgaacatagactcatcgatgacatggtggcccaagctatgaaa
tcagagggaggcttcatttgggcctgtaaaaactatgatggagatgtacagtcagactct
gtggcccagggttatggctcccttggcatgatgaccagtgtgctgatttgtccagatggc
aagacagtagaagcagaagctgcccatggcactgtgacccgtcactaccgcatgtaccag
aaaggacaggagacatccaccaatcccattgcttccatttttgcctggtccagagggctg
gcccacagagcaaagctcgataacaatgccgagctcagcttgtttgcaaaggctttggaa
gaagtctgcgttgagaccattgaagccggcttcatgactaaggacctggctgcttgcatt
aaaggtttacccaatgtgcaacgctctgactacttgaatacatttgagttcatggacaaa
cttggagaaaacttgaaggcgaagctagctcaggccaaactttaa

DBGET integrated database retrieval system