KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103744474
Entry
103744474         CDS       T03372                                 

Gene name
Cd28
Definition
(RefSeq) CD28 molecule
  KO
K06470  CD28 antigen
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04514  Cell adhesion molecules
ngi04660  T cell receptor signaling pathway
ngi04672  Intestinal immune network for IgA production
ngi04940  Type I diabetes mellitus
ngi05162  Measles
ngi05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ngi05320  Autoimmune thyroid disease
ngi05322  Systemic lupus erythematosus
ngi05323  Rheumatoid arthritis
ngi05330  Allograft rejection
ngi05332  Graft-versus-host disease
ngi05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    103744474 (Cd28)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    103744474 (Cd28)
   04672 Intestinal immune network for IgA production
    103744474 (Cd28)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103744474 (Cd28)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    103744474 (Cd28)
   05323 Rheumatoid arthritis
    103744474 (Cd28)
   05320 Autoimmune thyroid disease
    103744474 (Cd28)
   05330 Allograft rejection
    103744474 (Cd28)
   05332 Graft-versus-host disease
    103744474 (Cd28)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    103744474 (Cd28)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    103744474 (Cd28)
  09172 Infectious disease: viral
   05162 Measles
    103744474 (Cd28)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ngi04090]
    103744474 (Cd28)
CD molecules [BR:ngi04090]
 Proteins
  103744474 (Cd28)
SSDB
Motif
Pfam: V-set_2 V-set
Other DBs
NCBI-GeneID: 103744474
NCBI-ProteinID: XP_008844474
Position
Un
AA seq 216 aa
MTLGLLLLALNFFPSIQVAENKILVKQLPMLVAHNNEVNLSCNYTYNLLSKEFRASLYKG
VNSDVEVCNVSGNFSHQLQFHSNMGFNCDGNLDNETVTFYLRNLHVNQTDIYFCKIEVMY
PPPYIGNEKSNGTIIHVKEEHHCLAAELFWALVVVGGLLALYSFLVTLALSIFWTKSRRN
RLLQSDYMNMTPRRLGPTRKHYQPYAPARDFAAYRS
NT seq 651 nt   +upstreamnt  +downstreamnt
atgacactggggctgctgctcttggctctcaacttcttcccttcaattcaagtagcagaa
aacaagattttggtgaagcagttgcccatgcttgtggcgcataacaatgaagtcaacctt
agctgcaattacacctacaacctcctctcaaaggagtttcgggcatcgctttataaagga
gtgaatagtgatgtggaagtctgcaatgtgagtgggaatttttcccatcagcttcagttt
cactcaaatatggggttcaactgtgatgggaatttggacaatgaaacagtgacattctac
cttcggaatctgcacgttaatcaaacagatatttacttctgcaaaattgaggtcatgtat
cctcctccttacataggcaatgagaagagcaatggaacaatcattcatgtgaaagaggaa
catcattgccttgctgctgagctgttttgggcactggtggtggttggtggactcctggct
ctctatagcttcctagtgacactggctctcagtattttctggaccaagagcagaaggaac
aggctccttcagagtgactacatgaacatgactccccggaggcttggacccacccgcaag
cactatcaaccctacgccccagctagagactttgcagcctaccgctcctga

DBGET integrated database retrieval system