KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103744609Help
Entry
103744609         CDS       T03372                                 

Gene name
Atp1a3
Definition
(RefSeq) ATPase Na+/K+ transporting subunit alpha 3
  KO
K01539  sodium/potassium-transporting ATPase subunit alpha [EC:7.2.2.13]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04022  cGMP-PKG signaling pathway
ngi04024  cAMP signaling pathway
ngi04260  Cardiac muscle contraction
ngi04261  Adrenergic signaling in cardiomyocytes
ngi04911  Insulin secretion
ngi04918  Thyroid hormone synthesis
ngi04919  Thyroid hormone signaling pathway
ngi04925  Aldosterone synthesis and secretion
ngi04960  Aldosterone-regulated sodium reabsorption
ngi04961  Endocrine and other factor-regulated calcium reabsorption
ngi04964  Proximal tubule bicarbonate reclamation
ngi04970  Salivary secretion
ngi04971  Gastric acid secretion
ngi04972  Pancreatic secretion
ngi04973  Carbohydrate digestion and absorption
ngi04974  Protein digestion and absorption
ngi04976  Bile secretion
ngi04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    103744609 (Atp1a3)
   04022 cGMP-PKG signaling pathway
    103744609 (Atp1a3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    103744609 (Atp1a3)
   04918 Thyroid hormone synthesis
    103744609 (Atp1a3)
   04919 Thyroid hormone signaling pathway
    103744609 (Atp1a3)
   04925 Aldosterone synthesis and secretion
    103744609 (Atp1a3)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    103744609 (Atp1a3)
   04261 Adrenergic signaling in cardiomyocytes
    103744609 (Atp1a3)
  09154 Digestive system
   04970 Salivary secretion
    103744609 (Atp1a3)
   04971 Gastric acid secretion
    103744609 (Atp1a3)
   04972 Pancreatic secretion
    103744609 (Atp1a3)
   04976 Bile secretion
    103744609 (Atp1a3)
   04973 Carbohydrate digestion and absorption
    103744609 (Atp1a3)
   04974 Protein digestion and absorption
    103744609 (Atp1a3)
   04978 Mineral absorption
    103744609 (Atp1a3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    103744609 (Atp1a3)
   04961 Endocrine and other factor-regulated calcium reabsorption
    103744609 (Atp1a3)
   04964 Proximal tubule bicarbonate reclamation
    103744609 (Atp1a3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ngi04147]
    103744609 (Atp1a3)
Enzymes [BR:ngi01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.13  Na+/K+-exchanging ATPase
     103744609 (Atp1a3)
Exosome [BR:ngi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   103744609 (Atp1a3)
  Exosomal proteins of other body fluids (saliva and urine)
   103744609 (Atp1a3)
  Exosomal proteins of colorectal cancer cells
   103744609 (Atp1a3)
  Exosomal proteins of bladder cancer cells
   103744609 (Atp1a3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Cation_ATPase Hydrolase Cation_ATPase_N Hydrolase_3
Motif
Other DBs
NCBI-GeneID: 103744609
NCBI-ProteinID: XP_008844659
Position
Un
AA seq 1013 aa AA seqDB search
MGDKKDDKGSPKKNKAKERRDLDDLKKEVAMTEHKMSVEEVCRKYNTDCVQGLTHSKAQE
ILARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAYGIQAGTEDDPSGDNL
YLGIVLAAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVIREGEKMQVNAEEVVVGDL
VEIKGGDRVPADLRIISAHGCKVDNSSLTGESEPQTRSPDCTHDNPLETRNITFFSTNCV
EGTARGVVVATGDRTVMGRIATLASGLEVGKTPIAIEIEHFIQLITGVAVFLGVSFFILS
LILGYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGST
STICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGTSFDKSSHTWVALSHIAGLCNR
AVFKGGQDNIPVLKRDVAGDASESALLKCIELSSGSVKLMRERNKKVAEIPFNSTNKYQL
SIHETEDPSDNRYLLVMKGAPERILDRCSTILLQGKEQPLDEEMKEAFQNAYLELGGLGE
RVLGFCHYYLPEEQFPKGFAFDCDDVNFTTDNLCFVGLMSMIDPPRAAVPDAVGKCRSAG
IKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVIHGTDL
KDFTSEQIDEILQNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADI
GVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPF
LLFIMANIPLPLGTITILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPRTDKLVNERLI
SMAYGQIGMIQALGGFFSYFVILAENGFLPGNLVGIRLNWDDRTVNDLEDSYGQQWTYEQ
RKVVEFTCHTAFFVSIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSY
CPGMDVALRMYPLKPSWWFCAFPYSFLIFVYDEIRKLILRRNPGGWVEKETYY
NT seq 3042 nt NT seq  +upstreamnt  +downstreamnt
atgggggacaagaaagatgacaagggctcgcccaagaaaaacaaggccaaggagcgccgg
gacttggatgacctcaagaaggaggtggctatgacagagcacaagatgtcagtagaagag
gtctgccggaaatacaacactgattgcgtgcagggtctgacacacagcaaagcccaggag
atcctggcccgagatgggcctaatgcactcacaccaccacctaccaccccagaatgggtc
aagttctgtcgacagctctttgggggcttctccatcctgctatggatcggggccatcctc
tgcttcctggcctatggcatccaggcaggcactgaagatgacccttctggtgacaatcta
tacctgggcatcgtgctggcagctgtggtaatcatcaccggctgcttctcctactaccaa
gaggccaagagctccaagatcatggaatccttcaagaacatggttccccagcaagcccta
gtgatccgggaaggtgagaagatgcaggtcaatgctgaggaggtagtggtcggagaccta
gtggagatcaagggtggagatcgagtcccagctgacctgcgcatcatctcagcacatggc
tgcaaggtggacaactcctcattgaccggcgaatctgagccccagacccgctctccagac
tgcacacatgacaaccccttggaaactcggaacatcaccttcttttccaccaactgtgta
gaaggcactgctcggggtgtggtggtagccacaggtgaccgcactgtcatgggccgcatc
gccaccctggcctcaggcctggaggtgggcaagacgcccatcgccattgagattgagcac
ttcatccagctcatcaccggcgtggctgtcttcctgggtgtctccttcttcatcctctcc
ctcattcttggatacacctggctggaagctgtcatcttcctcattggaatcattgtggct
aatgtcccagaggggctgctggctactgttactgtgtgtctgacgctgacagccaagcgc
atggctcggaagaactgtctggtaaagaacctggaagctgtggagaccttgggatccaca
tccaccatctgttcagacaagacggggaccctaacccagaaccgcatgacagtcgcccac
atgtggtttgacaaccagatccacgaggctgacaccactgaagatcagtcagggacatct
ttcgacaagagttcacatacctgggtggccctgtcccacattgccgggctctgcaaccgt
gctgtcttcaagggtgggcaggacaacatccctgtgctgaagagggacgtggctggggat
gcctccgagtctgccctgctcaagtgcatcgagttgtcctcaggctctgtgaagctgatg
cgggagcgcaacaagaaggtggctgagattcccttcaactccactaacaaataccagctg
tctatccatgagactgaagaccccagtgacaaccgatacttgctggtgatgaagggcgcc
cctgaacgcattctggaccgctgctccaccatcctcctgcagggcaaagagcagccgctg
gatgaggagatgaaagaggccttccaaaatgcctacctggagcttggtggtctgggcgag
cgtgtgttgggtttctgccactattacctgccggaggaacagttccccaagggctttgct
tttgactgtgatgatgtgaacttcaccacagacaatctctgctttgtgggtctcatgtcc
atgattgaccctccccgggccgccgtccctgacgctgtgggcaagtgccgaagtgcaggc
atcaaggtcattatggtcactggcgatcaccccatcacggccaaggccattgccaaaggt
gtgggcatcatctccgaaggcaacgaaactgtggaggacattgctgcccgactcaacatc
cccgtgagccaggtcaacccccgggatgccaaagcctgtgtgatccatggcactgacctc
aaggatttcacttctgagcagattgacgagatcctgcagaaccacactgagatcgtcttt
gcccgaacctccccccagcagaagctcatcattgtagagggctgtcagagacagggagcc
attgtggctgtaactggtgatggtgtgaatgactcccctgctctgaagaaggctgatatc
ggggtggccatgggtattgctggctctgatgtttccaagcaggctgctgacatgattctg
ctggatgacaattttgcctccattgtcactggtgtagaggagggccgcctgatcttcgac
aacctgaagaaatccatcgcctacactctgaccagcaacatccccgagatcacacccttc
ctgctgttcatcatggccaacatcccgctgcctctgggcaccatcaccatcctctgcatt
gacctgggcaccgacatggtccctgccatctccctggcctatgaggctgccgagagtgac
atcatgaagagacagcccaggaacccacgcacagacaagctggtcaatgaaaggctcatc
agcatggcctatgggcagatcgggatgatccaggcccttggtggtttcttttcctacttt
gtgatcctggcagaaaatggcttcttgcctggcaacctggtgggcatccggctgaactgg
gacgaccgcactgtcaatgacttagaagacagctatgggcagcagtggacatacgaacag
aggaaagtggtggaattcacatgtcacacagccttctttgtgagcatcgtggtcgtccag
tgggctgatctgatcatctgcaagacccgaaggaactctgtcttccagcagggcatgaag
aacaagattctaatctttggcttgtttgaggagacagcccttgccgccttcctatcctac
tgcccgggcatggatgtggcccttcgcatgtaccctctcaagccgagctggtggttctgt
gccttcccctacagtttcctcatcttcgtctatgacgagattcgcaaactcatcctgcgc
aggaaccccgggggttgggtggagaaagagacctactattga

DBGET integrated database retrieval system