KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103744947Help
Entry
103744947         CDS       T03372                                 

Gene name
Pla2g4f
Definition
(RefSeq) phospholipase A2 group IVF
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi00564  Glycerophospholipid metabolism
ngi00565  Ether lipid metabolism
ngi00590  Arachidonic acid metabolism
ngi00591  Linoleic acid metabolism
ngi00592  alpha-Linolenic acid metabolism
ngi01100  Metabolic pathways
ngi04010  MAPK signaling pathway
ngi04014  Ras signaling pathway
ngi04072  Phospholipase D signaling pathway
ngi04217  Necroptosis
ngi04270  Vascular smooth muscle contraction
ngi04370  VEGF signaling pathway
ngi04611  Platelet activation
ngi04664  Fc epsilon RI signaling pathway
ngi04666  Fc gamma R-mediated phagocytosis
ngi04724  Glutamatergic synapse
ngi04726  Serotonergic synapse
ngi04730  Long-term depression
ngi04750  Inflammatory mediator regulation of TRP channels
ngi04912  GnRH signaling pathway
ngi04913  Ovarian steroidogenesis
ngi04921  Oxytocin signaling pathway
ngi05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    103744947 (Pla2g4f)
   00565 Ether lipid metabolism
    103744947 (Pla2g4f)
   00590 Arachidonic acid metabolism
    103744947 (Pla2g4f)
   00591 Linoleic acid metabolism
    103744947 (Pla2g4f)
   00592 alpha-Linolenic acid metabolism
    103744947 (Pla2g4f)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    103744947 (Pla2g4f)
   04010 MAPK signaling pathway
    103744947 (Pla2g4f)
   04370 VEGF signaling pathway
    103744947 (Pla2g4f)
   04072 Phospholipase D signaling pathway
    103744947 (Pla2g4f)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103744947 (Pla2g4f)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103744947 (Pla2g4f)
   04664 Fc epsilon RI signaling pathway
    103744947 (Pla2g4f)
   04666 Fc gamma R-mediated phagocytosis
    103744947 (Pla2g4f)
  09152 Endocrine system
   04912 GnRH signaling pathway
    103744947 (Pla2g4f)
   04913 Ovarian steroidogenesis
    103744947 (Pla2g4f)
   04921 Oxytocin signaling pathway
    103744947 (Pla2g4f)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103744947 (Pla2g4f)
  09156 Nervous system
   04724 Glutamatergic synapse
    103744947 (Pla2g4f)
   04726 Serotonergic synapse
    103744947 (Pla2g4f)
   04730 Long-term depression
    103744947 (Pla2g4f)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103744947 (Pla2g4f)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    103744947 (Pla2g4f)
Enzymes [BR:ngi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     103744947 (Pla2g4f)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B cPLA2_C2 C2
Motif
Other DBs
NCBI-GeneID: 103744947
NCBI-ProteinID: XP_008845035
Position
Un
AA seq 847 aa AA seqDB search
MLWVLWPRWLVGKGLPLVGAELLQKREKGPQWSCWRRETHPYYDLQVKVLRARNIQHTDL
LTKADCYVRLWLPTASASPAHTKTVANCSDPEWNETFHYQIHGAVKNVLELTLCDKDILG
SDKLSILLFDLRSLQPGQPHRHTFHLNQQESQELEVEFTLEKSQVPASEVITNGVLVAHP
CLRIQGTLKGDKTASHQEYGSRQIQLSVPGAYEKPQLVPLQLPTESGLPTFTFHVNPVLS
SRLQVELEEKLVVLQSDPSDELEAQTSKLGEMGILLSSLPLSQKEQCLVVLEEGQEVPLS
VKAEMSSGDLDLRLGFDLCDGELEFLDKRKQVVAKALQQVIGLSEAPHCDQVPVVAVLGS
GGGTRAMTSLYGSLAGLQELGLLDAVTYLSGVSGSTWCISTLYKDPFWSQVTLQGPIEHT
LAQVCSSKMGALSTEQLQYYSQELRLRESSGHSVSLVDFWALLIEYFLNREENPAKLSDQ
QEAVSQGQNPYPIYAGINVHTNISGEDFAEWCEFTPYEVGFPKYGAYVPTELFGSEFFMG
RLMQLRPEPRICYLQGMWGSAFAASLDEIFLKTAGSGLNFLEWHRGSVNVTDDCSKFQLQ
DPTRLRTRLCTPQGPFSQALLDIFTSRFTSAQNFNFTQGLCLHKDYVASREFMAWKDTHP
DAFPNELTPMRDCLSLVDGGFAINSPFPLIIQPQRAVDLIVSFDYSLEAPFEVLQMTEKY
CLDRGIPFPRIEVGPEDLEDPRECYLFTKAEDPRSPIVLHFPLVNRTFRTHLAPGVERQT
AEEKAFGDFDINGPDTPYGMMNFTYEPKEFDRLVALSRYNVLNNVVTVKHAFQLALDRGQ
ARGRVGS
NT seq 2544 nt NT seq  +upstreamnt  +downstreamnt
atgctctgggtcctctggccaaggtggctggtaggcaaggggctgccccttgtcggggca
gaactactgcagaagagagagaagggaccacaatggagttgctggcggagggaaacccat
ccatactatgacctccaggtgaaggtgctgagggccagaaacatccagcacacagacctc
ttgaccaaagctgactgctatgtgcgactgtggctgcccacagcctctgctagccctgcc
cacacaaagacagtggccaactgcagtgacccagagtggaacgagaccttccactaccaa
atccacggtgctgtgaagaatgtcctggagcttaccctctgtgacaaggatatcctggga
agtgataagctctccattctactgtttgacctgaggagtctccagccaggccagcctcac
aggcacaccttccatctgaaccaacaggagtcacaagagctggaggtggaatttactctg
gaaaagagtcaggtgcctgcatctgaagtcatcaccaacggggtcctggtggctcacccc
tgtctgagaatccagggcacactcaagggagataagacagcctcacatcaagagtatggc
tcaaggcagatccagttgtcagtgcctggggcctatgagaagccacagctagtacccctg
cagctgcccacagagtcaggcctacccacctttaccttccacgtgaacccagtgctgagc
tccaggctgcaggtagagttggaagagaagctggtagttctacagagtgacccaagtgat
gagctggaggctcagaccagcaagctgggtgagatgggcatcctgctgtcttctctgccc
ctcagccagaaggaacaatgccttgtggtactggaggagggccaggaggtacctctgagt
gtgaaggcagaaatgagctctggggacctggacctacgccttggctttgacctctgtgat
ggggagctggagtttctggacaagaggaaacaggtcgtggccaaggctctgcaacaagtt
ataggattgagtgaagctccacattgtgaccaggtgcctgtggtggctgtgttaggctct
ggaggtggaacccgagccatgacttccctgtatggcagtctggctgggctacaagagctg
ggcctcctggatgctgtgacctacctgagtggggtctctgggtccacctggtgcatctcc
acactctacaaggacccattctggtcccaggtgactttgcagggacccattgagcatacc
ctggctcaggtctgcagcagtaagatgggggcactgtccacagagcagctacaatactac
tctcaggaactgaggctccgggagagcagtggccacagtgtgtcccttgttgacttctgg
gccctcctcattgagtatttcctgaaccgagaggaaaatcctgccaagctgtcagaccag
caagaagcagtgagccagggtcagaacccttaccccatctacgccggcatcaacgtccac
accaacatcagtggggaggactttgcagagtggtgtgagttcaccccctatgaggtcggc
ttccccaagtatggggcttatgttcccaccgagctctttggttctgagttcttcatggga
cggttaatgcagctcaggccagaaccccgtatctgctacctgcagggtatgtggggtagc
gcttttgcagccagcctggatgagatcttcctgaagaccgcaggctcaggcctgaatttc
ctggaatggcatagaggcagcgtcaatgtcacagatgactgctcaaagttccagttgcag
gaccccacaaggctgcgcaccaggctctgtaccccacagggccccttttcccaggctctg
ctggacatattcacctcccgcttcacttctgcccaaaactttaacttcacccagggcctc
tgtctgcacaaggactatgtggctagcagggagttcatggcctggaaagacacacaccct
gatgccttccccaatgagctcacccccatgagggactgcctgtccctagtggatggaggc
tttgccatcaattcaccattcccactcatcatacagccccagcgggcagtggacctcatt
gtgtcctttgattactccttggaagccccttttgaggtcttacagatgacagagaagtac
tgcctggatcgagggatccccttccccaggattgaggtgggccctgaggacttggaggac
ccccgtgagtgttacctgttcaccaaggcggaggacccccgctcgcccatcgtgctacat
ttcccccttgtcaaccggacttttcgcacacatctggccccaggtgtagagcggcagaca
gctgaggagaaggcctttggggactttgacatcaatgggccagataccccctatggcatg
atgaacttcacctatgagcccaaggagtttgatcggctggtggccctgagtcgatacaat
gttttgaacaatgtggtgactgtgaagcatgccttccagctggctctggatcggggacag
gctaggggaagggttggtagctga

DBGET integrated database retrieval system