KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103745813Help
Entry
103745813         CDS       T03372                                 

Definition
(RefSeq) arylamine N-acetyltransferase 2-like
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi00232  Caffeine metabolism
ngi00983  Drug metabolism - other enzymes
ngi01100  Metabolic pathways
ngi05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    103745813
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    103745813
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    103745813
Enzymes [BR:ngi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     103745813
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acetyltransf_2
Motif
Other DBs
NCBI-GeneID: 103745813
NCBI-ProteinID: XP_008846038
Position
Un
AA seq 290 aa AA seqDB search
MDIEAYFERIGYKNSRSELDLETLTDIFQHQIQAIPFENFNLHCGGYMDLDLVAIFDQIV
KKKRGGWCLQINQLLYWVLTTMGFETTMLGGCIYIPPIHRYTNTPIHLLLQVTIRDKKYI
VDAAFLHSLQMWEPLELTCGKDQPQMPGIFRLTEENGTWYLDQIRREQYIPNQEFINSDL
LEKNKYRKMYSFTLKPRTIKHFEYINTYIQTSPVSLFVNTSLCSLQTPEGVHGLMGTTLI
CRKFNYKDNVDLVEIKTLKEEEIEETLRTIFGIHLETKLVPKHGRQYLPI
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggacattgaagcatactttgaaagaattggttataagaattccaggagtgaactggac
ttggaaactttaactgatatttttcagcaccagatccaagcaattccttttgaaaacttt
aacttgcattgtgggggatacatggatctggacttagtggccatttttgatcaaattgtg
aaaaaaaaaaggggtgggtggtgtctccagatcaatcagcttctctactgggttctgact
acaatgggttttgaaacaacaatgttgggaggatgtatttatatccctccaatccacagg
tataccaacactccaattcaccttctactgcaggtgaccatcagggacaaaaagtatatt
gtggatgctgcatttttacactctttgcagatgtgggagcctctggaattaacttgtggg
aaggatcagcctcagatgcctggcatcttccgcttgacggaagagaatggaacctggtac
ttggaccaaatcagaagagagcagtacattccaaaccaagaattcattaattctgatctc
ctggagaagaataaataccgaaaaatgtattcctttactcttaaaccccgaacaattaag
cattttgagtatataaacacctacattcaaacgtcaccagtgtctctgtttgtaaacaca
tcactttgttccttgcaaaccccggaaggggttcatggcctaatgggcactaccctcatc
tgtaggaagttcaattataaggataatgtagatctggtagagattaagactttgaaagaa
gaagaaatagaagaaacactaagaactatatttggtattcacttggaaacaaaacttgtg
cccaaacatggtagacagtatttgcctatttaa

DBGET integrated database retrieval system