KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103747045
Entry
103747045         CDS       T03372                                 

Gene name
Il5
Definition
(RefSeq) interleukin 5
  KO
K05428  interleukin 5
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04630  JAK-STAT signaling pathway
ngi04640  Hematopoietic cell lineage
ngi04657  IL-17 signaling pathway
ngi04658  Th1 and Th2 cell differentiation
ngi04660  T cell receptor signaling pathway
ngi04664  Fc epsilon RI signaling pathway
ngi04672  Intestinal immune network for IgA production
ngi05200  Pathways in cancer
ngi05310  Asthma
ngi05320  Autoimmune thyroid disease
ngi05321  Inflammatory bowel disease
ngi05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103747045 (Il5)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103747045 (Il5)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    103747045 (Il5)
   04660 T cell receptor signaling pathway
    103747045 (Il5)
   04658 Th1 and Th2 cell differentiation
    103747045 (Il5)
   04657 IL-17 signaling pathway
    103747045 (Il5)
   04664 Fc epsilon RI signaling pathway
    103747045 (Il5)
   04672 Intestinal immune network for IgA production
    103747045 (Il5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103747045 (Il5)
  09163 Immune disease
   05310 Asthma
    103747045 (Il5)
   05320 Autoimmune thyroid disease
    103747045 (Il5)
   05321 Inflammatory bowel disease
    103747045 (Il5)
   05330 Allograft rejection
    103747045 (Il5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103747045 (Il5)
   00536 Glycosaminoglycan binding proteins [BR:ngi00536]
    103747045 (Il5)
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  Interleukins
   103747045 (Il5)
Glycosaminoglycan binding proteins [BR:ngi00536]
 Heparan sulfate / Haparin
  Cytokines
   103747045 (Il5)
SSDB
Motif
Pfam: IL5
Other DBs
NCBI-GeneID: 103747045
NCBI-ProteinID: XP_008847570
Position
Un
AA seq 134 aa
MRVVLLLSMLALGAASIWAIAVEPSISTMVKQTLTLLSTHRALLTRNETVRIPVPTHKNH
QLCIGEIFRGIDTLRNQTAHGSAVEKLFQNLSLIKRYISHQKEKCGEERRRARQFLDYLQ
EFLGVLNTEWTLED
NT seq 405 nt   +upstreamnt  +downstreamnt
atgagagtggtcctgcttttgagcatgctggctcttggagctgcctccatttgggccata
gctgtggaaccttccatcagcaccatggtgaaacagaccttgacgttgctgtccactcac
cgagctctgctgacaaggaatgagacggtgaggattcctgttcctacacataaaaatcac
cagctgtgcattggagaaatcttccggggaatagacactctgaggaatcaaactgcccat
gggagtgctgtggaaaagctatttcaaaacttgtcattaataaagagatacatcagccac
cagaaagaaaagtgtggcgaggagagacgaagggcgaggcagttcctcgattacctgcag
gagtttcttggtgtgctgaatactgaatggaccttggaagactga

DBGET integrated database retrieval system