KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103747137Help
Entry
103747137         CDS       T03372                                 

Gene name
Nktr
Definition
(RefSeq) natural killer cell triggering receptor
  KO
K12740  NK-tumor recognition protein
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ngi03110]
    103747137 (Nktr)
Chaperones and folding catalysts [BR:ngi03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    103747137 (Nktr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-GeneID: 103747137
NCBI-ProteinID: XP_008847677
Position
Un
AA seq 1467 aa AA seqDB search
MGAQDRPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYK
GSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNG
SQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGVLATKS
AKDVFEKKRKKPTYSEDSDSSSNSSSSSESSSESEIERERSRRRKRKRRPKVKHTKKRRK
EVSSSEEPRNKRTVSPEGHSERSDTNEKRSADSNAKREKPVVRPEEIPPVPENRFLLRRD
MPAVTVEPEPKIPDVAPVVNDQKPSVSKSGRKIKGRGTIRYHTPPRSRSCSESEDDDSSE
TPPHWKEEMQRLRAYRPPSGEKWSKGDKLSDPCSSRWDERSLSQRSRSWSYNGYYSDFST
ARHSDGHHKKRRKEKRVKHKKKAKKQKHCRRHKQTKKRRVMPPDMKPSKSPTQRLKSSCD
RERRSRSSSSSPLSPHSSKRYWSKSDKDDQSSSTHSSRDSYRSKSHSRLDSRRSSRSRTL
SKSLSHSHSRSKSRSSSKSGRQRTASKSPRNTHLSESKAVKTEPLRSTIPQNGNVIVQPV
VAENVPVIPLSDSPPPSRWKPGQKPWKPSYERIQEMKAKTTHLLPIQSTYSLANIKETGS
SSSYHKRETNSESDRSAYSKYSDRSSESSRRSGSKSSRSVSYSRSYTRSRSHTLASSHSR
SRSPSSRSHSQNKYSDHSQQSRSSSYTSVSSDGRRRATRKFRSSGKKSITSNKRHSSSPE
KALPSKYMKCRAKSLCHRKYSENRSSLDDSMDSEQSSIQGMHSAPEKEKQGKMEVISDKQ
EKGRNEGKSKPEWECAHSEKRTLKDNLSDHSRNGSKSRRKNCAGSKWDSESNSERDVTKN
SKNDSRRSSDKEEGEATSDSESEVSESHVKTKPPTKSLANSSLPDSNGAWKSRRPQSSAS
DSEGSWSNLGNNRAESQKHKRGSKESLKREQTKKVKEKLKAKKDKKHKAPKRKQAFHWQP
PLEFGEEEEEEINEKQVTQESKEKKQISGKCETIKDSILKIEKSCDEGSFSNKRNKGTVS
EHDGLAEDDSKPDTCSEPLQVEGNATSSPPSTQHIEETIPAGVEDVLQTDDNMEICTPDR
NSPSKGEGASPLANRRPDSPEVSSVPKQDEHMANPGVEGTKQESSVSESKILGEAGKQDC
SSARLASTIEIAGKKNGAEKGQINLTDNKWKPLQGVGNLAVPTTTMSSTLEVKALATVPE
VKPQGLRIEIKSKNKVRPGSLFDEVRKTARLNRRPRNQESSSDEQTPSRDGDSQSRSPHR
SRSKSETKSRHRTRSVSYSHSRSRSRSSTSSYRSRSYSRSRSRGWYSRGRTRSRSSSYRS
YKSHRTSSRSRSRSSSYDPHSRSSRSYTYDSYYSRSRSRSRSQRSDSYHRGRSYNRRSRS
GRSYGSDSESDGSYSHHRSPSESSRYS
NT seq 4404 nt NT seq  +upstreamnt  +downstreamnt
atgggtgcgcaggaccggccgcagtgccacttcgatatcgagatcaaccgggagccggtt
ggtcgcattatgtttcaactcttctcagacatatgtccaaaaacatgcaaaaacttcctt
tgcttgtgctcaggggagaaaggccttgggaaaacaactgggaagaagttatgttataaa
ggttctacattccaccgtgtggttaaaaactttatgattcagggtggggacttcagtgaa
ggtaatggaaaaggtggagaatcaatttatggtggctattttaaagatgaaaactttatt
ctcaaacatgacagagcgttccttttgtcaatggcaaatcgagggaaacataccaatggt
tcccagtttttcataactacaaagcctgctccacacctggatggagttcatgttgtcttt
ggactggttatttctggttttgaagtaattgaacagattgaaaatctgaaaactgatgct
gcaagcagaccttatgcagatgtccgagttattgactgtggggtgcttgccacaaagtca
gcaaaagatgtttttgagaaaaaaaggaagaaaccaacatattcagaagactcggattct
tcttccaattcctcttcctcttcagaatcatcttcagaaagtgaaattgaacgagagaga
agcagaaggaggaaacgtaagaggagaccaaaagttaaacacactaaaaagagacgaaag
gaagtaagcagttcagaggaaccaaggaataagcgcacagtgagccctgaaggtcattct
gaaaggagtgatactaatgaaaaaagatcagctgattcaaatgctaaaagggaaaagcct
gttgtccgcccagaagagattcctccagtgcctgagaaccgatttttacttagaagagat
atgcctgctgtcactgtggagcctgaaccgaagattccagatgttgcacctgttgtaaat
gatcagaaaccatctgtatcaaagtctggacggaagattaaaggaagaggcacaattcga
taccacacacctccaaggtcaagatcttgttctgagtcagaagatgacgacagcagtgaa
actcctcctcactggaaagaggagatgcagagattgagagcatacagaccaccaagtgga
gagaagtggagtaaaggagataagttaagtgacccctgttcaagccgatgggatgaaaga
agcttgtcccaaagatccagatcatggtcctataatggatattattcagattttagtaca
gcaagacactctgatggtcaccacaaaaaacgcaggaaggaaaaaagagttaagcataaa
aagaaagctaaaaagcagaagcattgtagaagacacaaacagactaagaagagaagagtc
atgccacctgacatgaaaccctcaaaatctcccactcaacgattaaagtcctcttgtgat
agagaaaggagatctcgatcctcctcctcctccccattgtctcctcattcatcaaagagg
tactggtctaaatctgacaaagatgaccagagctcttcaacacactccagcagagactcc
tacagatctaagtcccactcacggttggattctagacgaagctcaagatcaaggactctg
tcaaaatccttgtcacattctcacagtagatcaaagtccagatctagttccaagtcaggg
cgccaaagaacagcatcaaagtcaccaagaaatactcatttgagtgaaagtaaggcagtt
aagacagaacctttaaggtcaacaataccacaaaatggaaatgtaatagtacagccagtg
gtggcagaaaatgttcctgtaataccattgagtgacagtccacccccttcaaggtggaag
cctggacagaagccatggaagccctcttatgagcgaattcaagagatgaaggctaaaaca
acccacttactgcccatccaaagcacctatagtttagcaaatattaaggagactggaagc
tcatcatcttatcacaaaagagaaacaaattcagaaagtgatcgaagtgcttattcaaaa
tacagtgacagaagttctgaaagttctcgaagatcggggagcaagtcttctaggagtgta
tcttactctagatcatacacaagatcaaggtcacatactctggctagttcacattcaagg
tctaggtctccatcgtctaggtctcattcacaaaataaatatagtgatcattcccagcaa
agtagatcatcttcatacacttccgttagcagtgatggtaggagacgagccacgaggaaa
tttagatccagtgggaaaaaaagtatcacttcaaataaaagacacagcagcagtcctgaa
aaggcacttccaagtaaatatatgaaatgtagagcaaagtctttgtgtcacagaaagtat
agtgaaaataggtcatctttagatgattctatggacagcgaacagtcaagtattcaaggt
atgcactcagccccagagaaggagaagcagggaaaaatggaagtaattagtgataaacag
gaaaagggcagaaatgaggggaaatccaagcctgaatgggaatgtgctcattcagaaaag
agaactttgaaagacaatctttctgatcactctagaaatggcagtaaatccagaaggaag
aattgtgctgggagtaaatgggattctgagtcaaattcagaaagagatgtaactaagaac
agtaaaaatgattcccggcggtcctctgataaggaagaaggtgaggccacttcagattcc
gaatcagaggttagtgaaagtcatgtcaaaaccaaacccccaacaaaatctttagcaaac
agttctctgcctgacagtaatggtgcttggaaatccaggagaccacaatcttcagcctct
gattcagagggctcctggtccaacttaggaaacaacagagcagagtctcaaaagcataaa
cgagggtcaaaggaaagtcttaaaagagaacaaacaaaaaaagtgaaagagaaattgaaa
gcaaaaaaagacaaaaaacacaaggctccaaagcgaaaacaggcctttcactggcagcct
ccactagagtttggtgaagaggaagaggaagagattaatgaaaagcaagttactcaggag
tcaaaagagaagaaacaaatatctggaaagtgtgaaactataaaagatagtattctgaaa
atagagaaatcctgtgatgagggcagcttttcaaataagcgtaataaagggactgtttca
gaacatgatgggcttgcagaggatgatagtaagcctgacacttgttcagaacctttacaa
gttgaggggaatgccactagctctcctcccagcacccagcacattgaagagactatccca
gctggagtggaggatgtgcttcagacagatgacaacatggagatttgcacccctgatagg
aattccccttcaaaaggagagggggcatcccctttagcaaatcgcaggcctgacagtcca
gaggtaagcagtgttccaaaacaggatgagcacatggcaaaccctggagtagaaggaaca
aagcaagaaagcagtgtttctgaaagtaaaatcctgggtgaagctgggaaacaggactgc
agttctgccagattggcaagtactatagaaattgctggaaagaagaacggggctgagaaa
ggtcagataaacctcacagataataaatggaagcccctgcaaggtgtagggaacctagca
gtacctactacgaccatgtccagtactcttgaagtgaaggcattggctactgtgcctgaa
gtgaagccacaaggcttgagaatagaaatcaaaagcaaaaataaagttcggccagggtct
ctctttgatgaagtaagaaagacagcacgcctaaaccggaggccaaggaatcaagagagt
tccagtgatgagcagactcctagtcgggatggggatagccagtccaggagtccacacaga
tctcgaagtaaatctgaaaccaagtctcgacacagaacaagatctgtctcctacagtcac
tcaagaagtcgttctagaagttccacatcatcttatcgatcaagaagctactctagaagc
cggagcagagggtggtacagcagaggccgaacccgcagccggagcagctcttaccgcagt
tacaaaagccacaggacatccagcaggagcaggtccaggagcagctcgtatgacccccac
agtcgttccagtaggtcctacacttacgatagctactacagtagaagtcgcagccggagt
cgcagccagaggagtgacagttaccaccgaggcagaagttacaataggcggtccaggagt
ggtagatcttacggctctgacagtgaaagtgatggaagttactctcatcatcggagcccc
agtgagagcagccgatatagttga

DBGET integrated database retrieval system