KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103747266Help
Entry
103747266         CDS       T03372                                 

Gene name
Ide
Definition
(RefSeq) insulin degrading enzyme
  KO
K01408  insulysin [EC:3.4.24.56]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi05010  Alzheimer disease
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103747266 (Ide)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ngi01002]
    103747266 (Ide)
Enzymes [BR:ngi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.56  insulysin
     103747266 (Ide)
Peptidases and inhibitors [BR:ngi01002]
 Metallo peptidases
  Family M16: pitrilysin family
   103747266 (Ide)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M16_M Peptidase_M16 Peptidase_M16_C Tn916-Xis
Motif
Other DBs
NCBI-GeneID: 103747266
NCBI-ProteinID: XP_008847842
Position
Un
AA seq 1019 aa AA seqDB search
MRYLLAWLLHPTLPGTLRCILGAGLSSPERLCGFQKKTYSKMSNPAIQRIEDQIVKSPED
KREYRGLELANGIKVLLISDPTTDKSSAALDVHIGSLSDPPNIAGLSHFCEHMLFLGTKK
YPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFLCPLFDASCKD
REVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRPNQEGIDVRDE
LLKFHSTYYSSNLMAICVLGRETLDDLTNLVVKLFSEVENKNVPLPEFPEHPFQEEHLRQ
LYKIVPIKDIRNLYVTFPIPDLQQYYKSNPGHYLGHLIGHEGPGSLLSELKSKGWVNTLV
GGQKEGARGFMFFIINVDLTEEGLLHVEDIILHMFQYIQKLRAEGPQEWVFQECKDLNAV
AFRFKDKERPRGYTSKIAGKLHYYPLNGVLTAEYLLEEFRPDLIDMVLDKLRPENVRVAI
VSKSFEGKTDRTEQWYGTQYKQEAIPDEVIQKWQNADLNGKFKLPTKNEFIPTNFEILSL
EKDATPYPALIKDTAMSKLWFKQDDKFFLPKACLNFEFFSPFAYVDPLHCNMAYLYLELL
KDSLNEYAYAAELAGLNYDLQNTIYGMYLSVKGYNDKQPILLKKITEKMATFEIDKKRFE
IIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDELKEALDDVTLPRLKAFIPQLL
SRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLLPSQLVRYREVQLPDRGWFVYQ
QRNEVHNNCGIEIYYQTDMQSTSENMFLELFCQIISEPCFNTLRTKEQLGYIVFSGPRRA
NGIQGLRFIIQSEKPPHYLESRVEAFLLTMEKSIEDMTEEAFQKHIQALAIRRLDKPKKL
SAECAKYWGEIISQQYNYDRDNIEVAYLKTLTKEDIIKFYKEMLAVDAPRRHKVSVHVLA
REMDSCPVVGEFPCQNDINLSQAPALPQPEVIQNMTEFKRGLPLFPLVKPHINFMAAKL
NT seq 3060 nt NT seq  +upstreamnt  +downstreamnt
atgcggtatctgctagcgtggctgctgcaccccacgctgcccggcaccttgcgctgcatc
ctcggcgctggcctgtcgtccccggagcgtctgtgtggtttccaaaaaaagacttacagc
aaaatgagtaatcctgctatccagagaatagaagaccaaattgtcaaatctcctgaagat
aaaagagagtatcggggactggaactggccaatggtatcaaagtgctcctcatcagtgac
cccaccacggacaagtcgtcagctgcacttgatgtgcacataggttcattgtcagatcct
ccaaatattgctggcttaagtcacttttgtgaacatatgctttttttgggaactaagaaa
tatcctaaagaaaatgaatacagccagtttctcagtgagcatgccggaagttcaaatgcc
tttactagtggagagcataccaattactattttgatgtttcccatgaacacttggaaggt
gccctggacaggtttgctcagtttttcctatgccccttgtttgatgcaagttgtaaagac
cgagaggtgaatgcagtggattcagaacatgagaagaatgtgatgaatgatgcctggaga
ctcttccagttggaaaaagctacagggaatcccaaacaccccttcagcaaatttgggaca
ggtaacaaatatactctagagactcgacccaaccaagaaggcattgatgtaagagatgaa
ctactgaaatttcattctacttactattcatccaatttgatggcgatttgtgttttaggt
cgagaaaccttagatgacttgactaatttggtggtaaagttgttttctgaagtagagaat
aaaaatgtcccattgccagaatttcctgagcacccttttcaagaagaacatcttagacaa
ctttataaaatagtacccattaaggatattaggaatctttatgtgacgttccccatacca
gatcttcagcaatactacaaatcaaatcctggtcattatcttggtcatctgattgggcac
gaaggtcccggaagcctgttatcagaactcaaatcaaagggctgggtaaatactctggtt
ggtggacagaaggaaggagcccgaggttttatgttttttatcattaatgtggacttaact
gaagaggggttattacatgttgaagatataattttgcacatgtttcaatacattcagaag
ttacgtgcagaaggacctcaagaatgggttttccaagagtgcaaggacttgaatgctgtt
gcttttaggtttaaagataaagagaggccacgaggctatacatctaagatcgcaggaaaa
ttgcattattatcccctaaatggagtactcacagctgagtatttactggaagaatttaga
cctgacttaatagacatggtccttgataaactcaggccagaaaatgtccgggttgcaata
gtttccaaatcatttgaaggaaaaaccgaccgcacagaacaatggtatggaacccagtac
aaacaagaagcaataccagatgaagtcattcagaaatggcaaaatgctgacctgaatggg
aaattcaagcttccaacaaagaatgaatttattcctacaaattttgagattttatcatta
gaaaaagatgcaacaccataccctgctcttattaaggatacagctatgagcaagctatgg
ttcaaacaagatgataagtttttcttgccaaaagcttgtctcaacttcgaatttttcagc
ccatttgcttatgtggaccccttgcactgtaacatggcctatttgtaccttgagctcctc
aaagactcactcaacgagtatgcatatgcagcagagctagcaggcttgaactatgaccta
caaaataccatctatgggatgtatctctcagtgaaaggttataatgacaaacagccaatt
ttgctaaagaagattactgaaaaaatggctacctttgagattgacaaaaaaagatttgaa
attatcaaagaggcgtatatgcgatctcttaataatttccgggctgaacagcctcaccag
catgctatgtactacctccgcttgctaatgactgaagtggcctggactaaagatgagtta
aaagaagccctagatgatgttaccctcccccgtcttaaggccttcatacctcagctactg
tcacgactgcacattgaagcccttctccatggaaatataactaagcaggccgcattagga
attatgcagatggttgaagacacccttattgaacatgcgcacaccaaacctctccttcca
agtcagctggttcggtacagagaagttcagctccctgacaggggatggtttgtctatcag
cagaggaatgaagtgcacaataactgtggcattgagatctactaccagacagacatgcag
agcacctcggagaacatgttcctcgagctgttctgtcagatcatctctgagccttgcttc
aacacccttcgcaccaaggagcagctgggctatattgtcttcagtgggcctcgtcgagcc
aatggcatacagggcttgcgattcatcatccagtcagaaaaaccacctcactacctggaa
agcagagtggaagctttcctacttactatggaaaagtccatagaggacatgacagaagag
gcgttccaaaaacacattcaagcattagcaattcggcgacttgacaaaccaaagaaactg
tctgcagagtgtgctaaatactggggagaaatcatctcccagcagtacaattatgacaga
gataacatcgaagttgcatatttaaaaacacttaccaaggaagatatcatcaaattctac
aaggaaatgctggcagtggacgcaccgaggagacataaggtatccgttcacgttcttgcc
agggaaatggattcttgtcctgttgttggagaattcccatgtcagaatgatataaattta
tcacaagcacctgccttgccacaacctgaagtgatccagaacatgactgagttcaaacgt
ggcttgccactgtttccccttgtgaaaccacacattaacttcatggctgcaaaactctga

DBGET integrated database retrieval system