KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103747353Help
Entry
103747353         CDS       T03372                                 

Gene name
Dlst
Definition
(RefSeq) dihydrolipoamide S-succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi00020  Citrate cycle (TCA cycle)
ngi00310  Lysine degradation
ngi00380  Tryptophan metabolism
ngi01100  Metabolic pathways
ngi01200  Carbon metabolism
Module
ngi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ngi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ngi_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    103747353 (Dlst)
  09105 Amino acid metabolism
   00310 Lysine degradation
    103747353 (Dlst)
   00380 Tryptophan metabolism
    103747353 (Dlst)
Enzymes [BR:ngi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     103747353 (Dlst)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-GeneID: 103747353
NCBI-ProteinID: XP_008847953
Position
Un
AA seq 454 aa AA seqDB search
MLSRSRCASRAFSRSLAAFQKGNCPLGRRSLPGVSLCQGPSYPDSRKIVINSNSVFSVRF
FQTTPFCKNDVITVQTPAFAESVTEGDVRWEKAVGDTVAEDEVVCEIETDKTSVQVPSPA
NGIIEALLVPDGGKVEGGTPLFTLRKTGAAPAKAKPAEAPTAASKAEPEAPAVPSPPVAS
IPTQMPPVPSPSQPPSSKPVSAIKPTAAPPLAEPGAAKGLRSEHREKMNRMRQRIAQRLK
EAQNTCAMLTTFNEVDMSNIQEMRARHRDAFLKKHNLKLGFMSAFVKASAFALQEQPVVN
AVIDDATKEVVYRDYIDISVAVATPRGLVVPVIRNVETMNYADIERTINELGEKARKNEL
AIEDMDGGTFTISNGGVFGSLFGTPIINPPQSAILGMHGIFDRPVAVGGKVEVRPMMYVA
LTYDHRLIDGREAVTFLRKIKAAVEDPRVLLLDL
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgctgtccaggtcccgctgcgcgtctcgggcgttcagccgctcactcgccgccttccag
aaggggaactgccctctagggagacgttccctgcctggggtctccttatgtcagggacca
agttaccctgacagcaggaagattgtcattaacagcaatagtgtcttcagtgttcgcttc
ttccaaaccacccctttttgcaagaatgatgtgattacagtccaaaccccagcgtttgca
gaatctgtcacagagggagatgtcaggtgggagaaagctgttggagatacagttgcagaa
gatgaagtggtttgtgagattgaaactgacaagacatctgtgcaggttccatcaccagca
aatggcatcattgaagctcttttggtacctgatgggggcaaagtcgaaggaggaactcct
cttttcacactcaggaaaactggtgctgctcctgctaaggccaagccagctgaagctcct
actgcagcctccaaagcagaacctgaagcaccagcagtcccttctccccctgtagcatcc
atacccactcagatgccaccagtgccctcgccctcacaacctccttctagtaaaccagtg
tctgcaataaaacccactgctgcccctccactagctgagccaggagctgctaaaggtctg
cgttcagaacatcgggagaaaatgaatagaatgcggcagcgcattgctcagcgtctgaag
gaagcccagaatacatgtgcaatgctgactactttcaatgaggttgacatgagtaacatc
caggagatgagagctcggcacagagatgctttcctgaagaaacataacctcaaactaggc
ttcatgtctgcatttgttaaggcctcagcctttgccttacaagagcagcctgttgtaaat
gcagtgattgatgatgcaaccaaagaagtggtatatagagattatattgacatcagtgtt
gcagtggccactccacggggtcttgtggttcctgtcatcaggaatgtggaaactatgaat
tatgcagacattgaacggaccatcaatgagctaggagagaaggctcgaaaaaatgaactt
gccattgaagatatggatggtggtactttcaccattagcaatggaggagtttttgggtct
ctctttggaacacccattatcaacccccctcagtctgccatcctgggcatgcacggcatc
tttgacaggcctgtggctgtgggaggcaaggtggaggtgcgacctatgatgtatgtagcc
ctgacttatgaccaccggctgattgatggcagagaggcagtaactttcctccgcaaaatc
aaggcagcagtagaggatccaagagtcctcctcctggacctttag

DBGET integrated database retrieval system