KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103747432Help
Entry
103747432         CDS       T03372                                 

Gene name
Anxa11
Definition
(RefSeq) annexin A11
  KO
K17095  annexin A7/11
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ngi04147]
    103747432 (Anxa11)
Exosome [BR:ngi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   103747432 (Anxa11)
  Exosomal proteins of other body fluids (saliva and urine)
   103747432 (Anxa11)
  Exosomal proteins of colorectal cancer cells
   103747432 (Anxa11)
  Exosomal proteins of bladder cancer cells
   103747432 (Anxa11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Annexin Ribosomal_S6e
Motif
Other DBs
NCBI-GeneID: 103747432
NCBI-ProteinID: XP_008848068
Position
Un
AA seq 503 aa AA seqDB search
MSYPGYPPPAGGYPPAAPGGGPWGSAAYPPPSMPPIGLDNVANYAGQFNQDYLSGMAANM
SGTFGGANMPSLYPGAPGGGYPPVPPGGFGQPPPAQQPVPPYGMYPPPGGNPPPGMPSYP
TYPGAPVPGQPMPPPGQQPPGAYPGQPPMTYPGQSPMPPPGQQPVPSYPGYPGSSTVTPA
VPPAQFGNRGTITNASGFDPLRDAEVLRKAMKGFGTDEQAIIDCLGSRSNKQRQQILLSF
KTAYGKDLIKDLKSELSGNFEKTILALMKTPVLLDVYEIKEAIKGAGTDEACLIEILASR
SNEHIRELNRVYKTEFKTTLEEAIRSDTSGHFQRLLISLCQGNRDESTNVDMSLVQRDVQ
DLYAAGENRLGTDESKFNAILCSRSRAHLVAVFNEYQRMTGRDIEKSICREMSGDLEQGM
LAVVKCLKNTPAFFAERLNKAMRGAGTKDRTLIRIMVSRSELDLLDIRAEYKRMYGKSLY
HDITGDTSGDYRKILLKICGGND
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgagctacccaggctatcccccacctgctggtggctaccctcctgctgcaccaggtggc
ggtccctggggaagtgctgcctaccctccccccagcatgcccccaattgggctggataac
gtggccaactatgcagggcagttcaaccaggactacctctcaggcatggcggccaacatg
tctgggacatttggaggagccaacatgccaagcctgtatcccggggctcctgggggtgga
taccctcccgtcccacctggtggctttgggcagcctccccctgcacagcagcctgtccct
ccctatggaatgtatccacccccaggagggaacccaccccctgggatgccctcatatcca
acatatccaggggcccctgtgccaggccagcccatgccaccccctgggcagcagccccca
ggggcctaccccggacagcctccaatgacctaccctggacagtcaccaatgccacctcca
gggcagcagccagtgccaagctatccaggatacccgggatccagtactgtcacccctgct
gtgccaccagcccagtttggaaaccgaggcaccatcacaaatgcttctggctttgacccc
ttacgagatgctgaggttctgcggaaagccatgaaaggctttggaacggatgaacaagcc
atcatcgactgcctagggagtcgctccaacaagcagcgacagcagatcctcctgtccttc
aagacagcctatggcaaggatttgatcaaagatctgaagtcagaactgtcaggaaacttt
gagaagacaatcttggccttgatgaagaccccggtcctacttgatgtgtatgagataaag
gaggccatcaagggagctggcactgatgaggcctgcctgatcgagatccttgcttcccga
agtaacgagcacatccgggagctgaacagagtctacaaaacagagttcaaaacaaccctg
gaggaggccattcgaagtgacacctcaggacacttccagcggctcctcatctctctctgt
cagggaaaccgtgatgagagcacaaatgtggatatgtcccttgtccagagagatgtccag
gacctgtatgcagctggggagaaccgcctgggaacagacgagtccaagttcaacgcaatt
ctgtgctcccggagccgggctcacctggtggcagttttcaatgagtatcagaggatgaca
ggccgcgacattgagaagagcatctgccgggagatgtctggggacctggagcagggcatg
ctggctgtggtgaaatgcctcaagaatactcctgctttctttgccgagaggctcaacaag
gccatgaggggagcaggaacaaaggaccggaccctgattcgcatcatggtgtctcgaagt
gagcttgacctcctggatatccgagcggaatataagcggatgtatggcaaatcgttgtac
catgacatcacgggagacacttctggggactatcggaagattctgctgaagatctgtggt
ggcaacgactaa

DBGET integrated database retrieval system