KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103747587Help
Entry
103747587         CDS       T03372                                 

Definition
(RefSeq) GPI transamidase component PIG-T-like
  KO
K05292  GPI-anchor transamidase subunit T
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
ngi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    103747587
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gpi16
Motif
Other DBs
NCBI-GeneID: 103747587
NCBI-ProteinID: XP_008848302
Position
Un
AA seq 120 aa AA seqDB search
MAVAMPLAALLLFLVAPWCWGRAERPRDSLREELVITPLPSGDVAATFQFRTRWDSELQR
EVSHYRLFPKALGQLISKYSLQELHLSFTQGFWRTRYWGPPFLQAPSGAELWVWFQDTVT
NT seq 362 nt NT seq  +upstreamnt  +downstreamnt
atggcggtggccatgccgctcgctgcgctcttgctgtttctcgtggctccctggtgctgg
ggccgtgccgagcgcccgcgggacagcctgcgagaggaactggttatcactccgctgcct
tccggcgacgtggccgccacgttccagttccgcacgcgctgggattcggagttgcagcgg
gaagtgtctcattacaggctcttccccaaagccctggggcagttgatctccaagtactct
ctgcaggagctgcacctgtcattcactcaaggcttttggaggacccggtactgggggcca
cctttcctgcaggctccatcaggtgcagagctctgggtctggttccaagacaccgtcact
ga

DBGET integrated database retrieval system