KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103748738Help
Entry
103748738         CDS       T03372                                 

Gene name
Hsd17b2
Definition
(RefSeq) hydroxysteroid 17-beta dehydrogenase 2
  KO
K13368  17beta-estradiol 17-dehydrogenase / 3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+) [EC:1.1.1.62 1.1.1.239]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi00140  Steroid hormone biosynthesis
ngi01100  Metabolic pathways
ngi04913  Ovarian steroidogenesis
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    103748738 (Hsd17b2)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    103748738 (Hsd17b2)
Enzymes [BR:ngi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.62  17beta-estradiol 17-dehydrogenase
     103748738 (Hsd17b2)
    1.1.1.239  3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+)
     103748738 (Hsd17b2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 DUF1776
Motif
Other DBs
NCBI-GeneID: 103748738
NCBI-ProteinID: XP_008849700
Position
Un
AA seq 381 aa AA seqDB search
MSPFCCESAWLCLAATTAVLGGIILSRSKSPRQLGSRVVCFAGLWGGACLLSLSLCYSLL
LFSLSCFLMYMYSSDQELLPVDQKAVLVTGTDSGFGHGLAKQLDKLGFTVFAGVLDERGP
GAEELRKTCSKRLLVLQMDITKLEQIKDAHSKVLEKTQDTGLWALVNNAGVFHLPIDGEL
IPMSSYRKCMAVNFFGAVEVTKVFLPLLRKSKGRLVNVSSMGAEVPIQMMAAYSSTKAAL
TMFSSILRQELFKWGVKVAIIEPGGFSTNFPGTPDLWEKMEKDVLDHLPKEVQEDYGQDY
IQLQKDTLKIMKTRSSPDITPVLRDIQHAISSKNPFPIYTPGRLTYLWIFIASCSPISLL
DYISQKIFKPKHLPRSLSTPY
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgagtccgttttgctgtgagtcagcatggctctgcctggcggccaccaccgcagtgctg
gggggcatcattctgagcagatctaagagcccacggcagctggggagccgggtggtgtgc
ttcgctgggctctggggaggtgcttgcctgctcagcctgtccctctgctacagcttactc
ctcttctccttgtcctgctttctcatgtatatgtattcatctgaccaagagctgttacct
gtggatcaaaaggcagtgctggtgacaggtactgattccggttttggccacggtttggcc
aaacagttggacaagctgggcttcacggtgtttgccggagttctggatgaaaggggacca
ggggcagaggaattgagaaaaacctgctccaagcgcctcttggtgcttcagatggacatc
accaagctggaacagataaaagatgctcacagcaaagtcctagagaagacacaggacaca
ggactgtgggctctggtcaacaatgctggcgtcttccatttgccgatagacggggagctc
attcctatgagcagctaccggaagtgcatggccgtgaacttcttcggagcggtggaggtt
acaaaggtcttcctgcctctgctcagaaaatccaaggggagactggtcaatgtcagcagc
atgggagctgaggtcccaatacaaatgatggcagcctacagttctaccaaggcagctctg
accatgttttcatccatcttgagacaagagctcttcaaatggggagtcaaagttgccatc
atcgaacccggaggcttcagtacaaacttcccaggcacacctgacctttgggaaaagatg
gagaaggatgtcctggaccacctccccaaagaggttcaggaagactatggccaggactac
atccagctgcagaaggacacccttaagatcatgaagaccaggtccagcccggacattacc
ccggtgctccgggatatccaacatgccatttcttcgaagaaccccttccccatttatacc
ccagggaggctgacttacctgtggatcttcattgcctcctgttccccaatcagcttattg
gactatatttcacaaaagattttcaagccaaaacacctgccaagatctctaagcacgcca
tattag

DBGET integrated database retrieval system