KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103748790Help
Entry
103748790         CDS       T03372                                 

Gene name
Dock8
Definition
(RefSeq) dedicator of cytokinesis 8
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ngi04131]
    103748790 (Dock8)
Membrane trafficking [BR:ngi04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    103748790 (Dock8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2
Motif
Other DBs
NCBI-GeneID: 103748790
NCBI-ProteinID: XP_008849826
Position
Un
AA seq 1221 aa AA seqDB search
WLPILLNERLQTGSYCLPVALEKLPSNYFMHSAEKVPLQNPPIKWAEGHKGVFNIEVQAV
SSVHTQFAFESVVAIANSLHNSKDLSKDQHGRNCLLASYVHYAFRLPELHRDMHKSGGPA
ATQDPRYHTYGCTSAATVSSKLMQARVMSSSNPDLAGTHCAADEEVKNIMSSKVADRNCS
RMSYYCSGNNDAPGSTAAPRPANKKHFHEELALQMVVSTGMVRETVFKYAWFFSELLVKS
MAQYVHNLDKRDSFRKTRFSDRFKDDITTIVNVVTSEIAALLVKPQKESEQAEKINISLA
FFLYDLLSLMDRSFVFNLIKHYCNQLSAKLNNLPTLISMRLEFLRILCSHEHYLNLNLFF
LNTDTAPVSPCPSISSQNSSSCSSFQDQKIASMFDLTPEYRQQHFLTGLLFTELAVALDS
EGDGISRVQRKAVSAIHSLLSSHDLDPRCVKSEVKVKIATLYLPLVGIILDALPQLYDFT
AADARSGKSRSSGSYEEQDVTSGINQNVALAIAGNHFNLKTSGSLLSSLPYKQYNMLNAD
TTRNLMICFLWIMKNADQSLIRKWIADLPSMQLNRILDLLFICVSCFEYKGKQSSDKVSN
QVLQKSRDVKARLEEALLRGEGARGEMMRRRTPGNDRFPGLNENLRWRKEQTHLWQANEK
LDKTKAELDQEALISGNLATEANLIILDMQENIIQASSALDCKDSLLGGVLRVLVNSLSC
DQSTTYLTHCFATLRALIAKFRDLLFEEEVEQCADLCQRVLHHCSSSIDVTRSQACATLY
LLMRFSFGATSNLARVKMQVTISLASLVGKAPDFNEEHLRRSLRTVLAYSEEDTAMQTTP
FPIQVEELLCNLNSILYDTVKMREFQEDPEMLMDLMYRIAKSYQASPDLRLTWLQNMAEK
HTKRKCFTEAAMCLVHAAALVAEYLSMLEDHSYLPVGSVSFQNISSNILEESAVSDDTLS
PDEDRVCSGQYFTESGLVGLLEQAAELFSTGGLYETVNEVYKLVIPILEAHRDFRKLAST
HDKLQKAFDHIINKDHKRMFGTYFRVGFYGSKFGDLDEQEFVYKEPAITKLPEISHRLEG
FYGQCFGTEFVEVIKDSTPVDKTKLDPNKGPLEVAQVFLAEIPADPKFYRHHNKLRLCFK
EFIMRCGEAVEKNKRLITAEQREYQQELKKNYNKLRESLRPMIERKIPELYKPIFRADSQ
KRDSFHRSSFRKCETQLSQGS
NT seq 3666 nt NT seq  +upstreamnt  +downstreamnt
tggctgccgattctcctaaatgaacgtcttcaaactggatcctactgtctcccagttgcc
ttggaaaaactgccatccaactacttcatgcattctgctgagaaagtccctctacagaat
cctcccattaagtgggccgagggccataagggagtatttaatattgaagtgcaagctgtt
tcttccgttcacacccagtttgccttcgagtccgtggtggccattgccaacagtctgcac
aacagcaaggacctgagcaaggaccagcacgggaggaactgcctgctggcatcctatgtg
cactacgccttccggctgcctgagctgcacagggacatgcacaaatcaggtggtcctgct
gccacccaggatccccgctaccacacgtatggatgcacatctgctgccaccgtgagttca
aagctgatgcaggcccgagtgatgagtagcagcaatccagacctggcggggacacactgt
gcagcagacgaggaagttaagaacatcatgtcttcaaaggttgctgatcgcaactgcagc
cggatgtcttactattgctctggcaataatgatgctccaggttcaactgcagcccccagg
ccagccaacaaaaagcattttcatgaggagcttgccctgcagatggtggtcagcactgga
atggtgagagaaacggtcttcaagtacgcctggttcttctccgaacttctggtgaaaagc
atggcccagtatgtgcataacctggacaaacgtgacagttttcggaagactcgcttttct
gaccgcttcaaagatgacataactaccattgttaatgtggttacctcagagattgcagcc
cttttagtgaaacctcagaaggaaagtgaacaggcagaaaagatcaacatcagccttgct
ttcttcttatacgacctcctctcactcatggaccgcagctttgtgttcaacctcatcaaa
cattactgcaaccagctatcagccaagcttaataaccttccaacgctcatttccatgagg
ctggagttcctgaggatcctctgcagccacgaacattacctcaacctcaacctcttcttc
ttgaacactgatactgcacccgtgtctccctgtccctccatatcctcccagaactcaagc
tcctgttccagtttccaggaccaaaagattgccagcatgttcgatctgaccccagagtac
cgccagcagcactttctcacggggctcctcttcacagaactggctgtcgccctggattct
gaaggggatggaatcagcagagtgcagaggaaagccgtaagcgccatccacagtctgctg
agttcccacgatctggatccacggtgtgtcaaatcagaggtgaaggtcaaaatcgccacc
ctttacctgcctttggttggcatcatcctggatgctttgccacagctctatgactttaca
gctgcagatgctcgaagtgggaagagccgcagcagtggctcgtatgaagaacaagatgtg
accagtggaatcaaccagaatgtggccctggccatagcagggaatcattttaacttgaag
acaagtggatcattgttgtcttccttgccctataagcagtacaacatgctgaacgcagat
accacccgcaacctcatgatctgcttcctctggatcatgaaaaatgccgatcagagcctc
attaggaagtggattgctgacctaccttccatgcaactgaacaggattctagacctgctt
ttcatctgtgtctcctgtttcgagtacaagggaaagcagagttctgacaaagtcagtaac
caagtgctgcagaagtcgagggatgtcaaagccagactggaagaggccctgctccgtgga
gaaggggcccgaggggagatgatgcgccgtcgtactccagggaatgaccgatttccaggc
ctaaatgaaaatttgagatggaggaaagagcagacacatttgtggcaagctaatgagaag
ctagataaaacaaaggcagaattagatcaagaagccttgattagtggcaatttggctaca
gaagcaaatttaatcatcctggatatgcaggaaaacattatccaggcaagttcagccctg
gactgtaaagacagcctgctgggaggtgtcctgcgagtcctggtgaattctctgagctgt
gatcagagcaccacctacctgactcactgctttgcaacacttcgagccctcattgccaag
ttcagagacttgttgtttgaggaggaggtggagcagtgtgcggacctgtgtcagcgagtg
ctgcaccactgcagcagcagcatagacgtcacgcggagccaagcctgtgccaccctctac
ctcctcatgcgcttcagttttggagccaccagtaacctcgcgagagtaaagatgcaagta
accatatctctggcatctttggtgggcaaagcaccagactttaatgaagagcacctgaga
agatccttgaggacagttctagcctattcagaagaggacacggccatgcagaccactcct
tttcccatccaggtggaggaacttctctgcaatctgaatagcattttatatgacactgtg
aaaatgagggaatttcaggaagatcctgagatgctcatggatctcatgtacagaattgcc
aagagctaccaggcgtctcctgacctgcggctgacctggctccagaacatggcagagaag
cacacgaagaggaagtgcttcacagaggccgccatgtgcctcgtgcacgcggctgccttg
gtggctgagtatctgagcatgctggaggaccacagctacctgccggtgggcagcgtcagc
tttcagaatatttcttctaacatcctggaggagtctgccgtctctgatgataccttgtca
cccgatgaggacagagtgtgctctggtcagtactttacagagagtggacttgtgggcctc
ctggaacaggctgcagagctcttcagcacgggaggcttgtatgagacggttaatgaggtc
tacaagctggtcatccccatcctggaagcgcatcgggacttccggaagctggcctctaca
cacgacaagctgcagaaggcctttgaccacatcatcaacaaggatcataagaggatgttt
ggaacttacttccgagttggtttctatggttccaaatttggggatttggatgagcaagaa
tttgtttacaaggagcctgcaattactaagcttcccgagatctcacatagactagaggga
ttttatggtcagtgttttggtacagaatttgtggaagtgataaaagactccactcctgtg
gacaaaaccaaactggatcccaacaagggacccctggaggtagcccaagtgttcttggct
gaaattccagctgatccaaagttctatcgacatcacaataagctgaggttatgctttaag
gaattcataatgcgatgtggtgaggctgtggagaagaacaagcggctcatcacagcagag
cagagggagtaccagcaggaactcaagaagaactacaacaagctgagggagagcctcagg
cctatgatagagaggaaaattccagagctctacaaacccatcttcagggctgacagtcag
aagagagactccttccacagatctagtttcaggaaatgtgaaactcaattgtcacagggg
agctaa

DBGET integrated database retrieval system