KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103749068Help
Entry
103749068         CDS       T03372                                 

Gene name
Gpx3
Definition
(RefSeq) glutathione peroxidase 3
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi00480  Glutathione metabolism
ngi00590  Arachidonic acid metabolism
ngi01100  Metabolic pathways
ngi04918  Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    103749068 (Gpx3)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    103749068 (Gpx3)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    103749068 (Gpx3)
Enzymes [BR:ngi01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     103749068 (Gpx3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx
Motif
Other DBs
NCBI-GeneID: 103749068
NCBI-ProteinID: XP_008850098
Position
Un
AA seq 226 aa AA seqDB search
MARLLRASCLLSLLLAGFVPPGRGQEKSKTDCHGGMSGTIYEYGALTIDGEEYIPFKQYA
GKYVLFVNVASYUGLTDQYLELNALQEELGPFGLVILGFPCNQFGKQEPGENSEILPSLK
YVRPGGGFVPNFQLFEKGDVNGEKEQKFYTFLKNSCPPTAELLGSPGRLFWEPMKMHDIR
WNFEKFLVGPDGIPIMRWYHRTTVSNVKMDILSYMRRQAALGARGK
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggcccggctcctccgggcatcctgcctcctgtccctgctcctggccggcttcgtcccg
cccggccggggacaagagaaatccaagacagactgccacgggggcatgagcggcaccatc
tacgagtacggggccctcaccattgatggggaggagtacattccctttaagcagtacgct
ggcaaatatgtcctcttcgtcaatgtagccagctactgaggcctaacagaccagtacctt
gaactgaatgcactacaggaagagcttgggccgtttggattggtcatcctgggcttcccc
tgcaaccaattcggcaaacaggagccgggcgagaactcagagatcctacctagtctcaag
tatgtccgaccaggaggaggctttgtccctaacttccagctctttgagaaaggggacgta
aacggggagaaggagcagaagttctacacgttcctgaagaactcctgcccgcccaccgcg
gagctcctgggctcacctggccgcctcttctgggaacccatgaagatgcatgacatccgc
tggaactttgagaagttcctggtggggccagacggcatacccatcatgcgctggtaccac
cggaccacagtcagcaacgtcaagatggacatcttgtcctacatgaggcggcaggcagcc
ctgggggccagagggaagtaa

DBGET integrated database retrieval system