KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103749662
Entry
103749662         CDS       T03372                                 

Gene name
Ahrr
Definition
(RefSeq) aryl-hydrocarbon receptor repressor
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ngi03000]
    103749662 (Ahrr)
Transcription factors [BR:ngi03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    103749662 (Ahrr)
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_9 PAS_4
Other DBs
NCBI-GeneID: 103749662
NCBI-ProteinID: XP_008850708
Position
Un
AA seq 706 aa
MMIPPGECTYAGRKRRKPIQKRRPIMGAEKSNPSKRHRDRLNTELDHLASLLPFPPDIIS
KLDKLSVLRLSVSYLRVKSFFQVLQETRAWPAQALSPKDHPYGGFPVQEGRLLLESLNGF
ALVVSAEGMIFYASATIVDYLGFHQTDVMHQNIYDYIHVDDRQDFCRQLHWAMDPPQAVF
GHPPHAEADNSILGKLLRAQEEGKGSPSEYSAFLTRCFICRVRCLLDSTSGFLMMQFQGK
LKFLFGQKKKAPSGTALPPQLSLFCTVVPVLPSMAEMKMKSALLRAKHRADIVARTDSRA
KAVTSLCEAEFHPKPSYLAGRSNGENSISVFRAQMDRGHWARALARPSCLCLRSGPDLFL
DPKGASGDREEEDQEPILRGSPGARGQRETHRYNRCSDTPAPSRHLNWSTEQHSQEGSTK
LSRQPSKTEPSACPVSHGSSLPYPSTQDMFSASGMASFRDSPDHSAGAYCSQMNRPLQDI
HQSQGHPPPCHVPQGSLGTRFPLPRMQRFTARDFSTEDAKLSSLPVTIGTPCNLALSLEV
PIKMENESGPQDIVDGCTPRRAWLGASDMARKHLVSFPTRMHLKTEPDCRQQVFTPHPGH
GVLEASQHSRATVGTHRELGPLYPAHCACLEPEPSHHLCMWGHSDSQYSTLSCDCRASGM
APVVKREPLDSPPWATPGQVSVPRMFPKSASVALIPPRASEGGFLP
NT seq 2121 nt   +upstreamnt  +downstreamnt
atgatgattccacccggagagtgcacatatgccggcaggaagagaaggaaacccattcag
aagcggaggcctatcatgggagctgagaaatcaaacccttccaagaggcacagggaccgt
ctcaacacagaactggaccacctggccagcctgctgccattcccacctgacatcatctcc
aagctggacaagctttccgttctgcgtctcagcgttagttacctcagagtgaagagcttc
tttcaagtcttgcaggaaacgcgtgcatggccagcccaggccctctcacccaaagaccat
ccatatggagggttccctgtgcaggaaggacggctgctgctggagtctctcaatggcttt
gctctggtggtgagtgcagaagggatgatcttttatgcttcagcaacgattgtggactat
ctgggcttccaccagacagatgtaatgcaccaaaacatttatgactacatccatgtggat
gaccgtcaggacttctgccggcaactgcactgggccatggaccctccacaggcagtgttt
ggacaccccccacatgctgaggcagataacagcatcctggggaagcttctcagggcccag
gaagagggtaagggctcaccctcggagtactcggcctttctgacacgctgcttcatctgc
cgtgtacgttgcttgctggacagcacctctggatttctgatgatgcagttccaaggaaaa
ttaaaattcctgtttggacagaagaagaaggcaccatcaggaacagccctgccccctcag
ctctcactgttctgcactgtggtgccagtcctgccttccatggctgagatgaaaatgaaa
agtgcattattgagagcaaaacacagggcagacattgtcgccaggacggactccagggca
aaagctgttacaagtctttgtgaagcagaatttcatcccaaacccagttacttagcagga
aggagcaatggagaaaacagcatttcggtgttcagggcacagatggatagaggtcactgg
gctcgggctctagccaggccctcatgcttgtgcctcagaagtggtcctgatctcttcttg
gaccccaagggggcttcaggggacagagaagaagaggatcaagagcccattctaagggga
tcccctggagccaggggacaaagggaaacacaccggtacaatcgctgttcagacacacca
gcaccttcgaggcacctgaactggagcacagaacagcacagtcaggagggctctaccaaa
ttaagtcggcagcccagcaagactgaaccatctgcatgccctgtgtcccatggttcttct
cttccctaccccagtacccaggacatgttcagtgcaagtggcatggcttctttcagagat
tcaccagaccattctgctggtgcctactgcagccagatgaacagacctttgcaggacatc
caccagagccaggggcatcctcccccatgtcatgtccctcagggcagcctggggaccagg
ttccctctgcccagaatgcagcgcttcacagccagggatttctccacagaggatgcaaag
ttatccagtctaccagtaaccataggcaccccatgtaatctagcattgtcactggaagtg
ccgatcaagatggaaaatgaatctgggccccaggacatagtagatggctgtacccctcgc
cgggcgtggctgggagccagcgacatggccaggaaacatctggtcagtttccctaccagg
atgcatctgaaaacagagccagactgtagacagcaggtcttcaccccacaccctgggcat
ggtgtgctggaggcgagtcaacacagcagggccactgttggaactcacagggagctgggc
cctctctaccctgcacattgtgcctgcttggaaccagaaccttcccatcacctctgcatg
tggggccacagtgacagccagtactccactctgagctgtgactgtagagcttctggtatg
gcccctgttgttaagcgtgagcccttggactcacctccatgggctactcctggccaggta
tctgtgcccaggatgtttcccaagagtgcctctgtggcattgatcccacccagagcctct
gaaggaggttttctaccttaa

DBGET integrated database retrieval system