KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103750093Help
Entry
103750093         CDS       T03372                                 

Definition
(RefSeq) biotin--protein ligase-like
  KO
K01942  biotin---protein ligase [EC:6.3.4.9 6.3.4.10 6.3.4.11 6.3.4.15]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi00780  Biotin metabolism
ngi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    103750093
Enzymes [BR:ngi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.9  biotin---[methylmalonyl-CoA-carboxytransferase] ligase
     103750093
    6.3.4.10  biotin---[propionyl-CoA-carboxylase (ATP-hydrolysing)] ligase
     103750093
    6.3.4.11  biotin---[methylcrotonoyl-CoA-carboxylase] ligase
     103750093
    6.3.4.15  biotin---[biotin carboxyl-carrier protein] ligase
     103750093
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BPL_N
Motif
Other DBs
NCBI-GeneID: 103750093
NCBI-ProteinID: XP_008851253
Position
Un
AA seq 485 aa AA seqDB search
MEDRLQMDNGLIPQKIVSVHLKDSTLKELQDQVSNKQVQALQPSPEPSPEAEPMQDIMEH
AGQGDSKAPREVCSLSRRGSVSGRGPAADGEPGQGSVEHHQLHLSSCHECLELENSTIES
VRFASAENIPDLPYDHSSTLGGAGEFFPEREGRRVNISGKAPNILLYVGSSCQEALGRLQ
QVQSVLADCVDTDSYVLYHLQEDSALRDPWPDNCLLLVIATREPVPEGLYQKFMAYLAQG
GKVLGLSSSFRFGGFQVTSKGMLQNTVQNLVFSKADQSKVQLSVLSSGYVYYEDPGEQPS
PGMLQGHLQNGDKDRMIVQVPFGTRGGEAVLCQVHLELPPSSPIVQTQEDFNLLKSSNMR
RHEVLKEILTTLGLSCDTQQVPTLTPLHLLPATDEIRNSFMQWLERHVDPEGVIKSSKLS
LKFISSCTSEVEITPSSIPVVTDSETFSSEHFNLEIYRQNLQSTRLGKVILFAEVTPTTM
SLLDG
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atggaagacagactgcaaatggataatggactgataccccaaaagattgtttcagtgcac
ttgaaggactctactctgaaggaactccaggatcaggtctccaacaagcaagtccaagcc
ctgcagccaagcccagaaccttcccctgaggctgagcctatgcaagacatcatggagcat
gctggtcaaggtgactcaaaggctcctcgtgaagtctgttccctgtcaaggagaggcagt
gtctctggaagggggccggctgcagatggcgagccagggcagggctctgttgagcaccat
cagctccacctgtccagttgccacgagtgtttagaactcgagaacagcaccattgaatca
gtgaggtttgcatcagcagagaacattccagatcttccctatgatcacagcagcactttg
gggggtgctggtgagttcttccctgaaagagaagggaggagagtcaacatctcaggaaag
gcacccaacatcctcctgtatgtgggctccagctgccaggaagccctgggccggctccag
caggtgcagtctgtcctggctgactgtgtggacaccgacagctatgttctctaccacctg
caggaagacagtgccctcagggacccatggccagacaactgcctgctcttggtcattgcc
accagggagcctgtccccgaaggcctgtaccagaaattcatggcctatctcgctcaagga
gggaaggtgctgggcctgtcttcctccttcaggtttggtggctttcaggtgacaagcaag
ggcatgctgcagaacacagtccagaacttggttttctccaaggctgaccagagtaaggtg
cagcttagcgtcctgagcagcggctatgtttattacgaggaccctggagaacagcccagc
cctggcatgctgcagggccacttacagaatggggacaaagacaggatgatcgtgcaagtg
ccttttggaacccgtggaggggaggccgtcctctgccaggtgcatctagaacttcctccc
agctctcccatagtgcaaacgcaagaagacttcaacttgctcaaatcaagcaatatgcga
aggcatgaagtcctaaaggagatcctgaccaccctcggcctgagctgtgatacacaacaa
gttcctaccttaaccccgcttcatttactgccggccactgacgaaatccggaattcattt
atgcagtggctggagagacatgtggatcctgaaggagtcataaaatcgagcaagctctcc
cttaaattcatttcatcttgcacatctgaagtagaaatcaccccatcttccatacctgtg
gttacagattcagaaaccttctcatcggagcactttaacctagagatctaccgacaaaac
ctgcagagcacacggctcggaaaagtaattctgtttgcagaagtgacccccacaaccatg
agtctcttggatgggtga

DBGET integrated database retrieval system