KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103750461Help
Entry
103750461         CDS       T03372                                 

Gene name
Pik3c2a
Definition
(RefSeq) phosphatidylinositol-4-phosphate 3-kinase catalytic subunit type 2 alpha
  KO
K00923  phosphatidylinositol-4-phosphate 3-kinase [EC:2.7.1.154]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi00562  Inositol phosphate metabolism
ngi01100  Metabolic pathways
ngi04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    103750461 (Pik3c2a)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    103750461 (Pik3c2a)
Enzymes [BR:ngi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.154  phosphatidylinositol-4-phosphate 3-kinase
     103750461 (Pik3c2a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_C2 PI3K_rbd PX C2 DUF4135
Motif
Other DBs
NCBI-GeneID: 103750461
NCBI-ProteinID: XP_017658754
Position
Un
AA seq 1657 aa AA seqDB search
MAQISNNSEFNQCSSSHLEPMQTKDVDKAEALQMEAEALARLQKDRQGTDSQRGLEWSSS
TRQRSQGFHAQEYDLMVFPESDSQKKGVDIDVEKLTQAELEKLLLDDTFETRKAPMLPVA
PVVSPSFSAQLYLRPTVVQRGQWPPGLSGPSTYTLPSVYPSVYSKQATFQNGFNPRMPTF
PSTEPLYLRLPGQSPYFSCPLTPGTPVHPQGSLPIYRPLVSPDMAKLFDKIASTSEFLKN
GRARTDLEITHSQPSISSLQVSPKTEDISKFDWLDLDPLSKPKMDSVELLDLEEEKKIPS
LLAEDPWDAVLLEERSPASCQLGRKSNGTSLSGATVTRSQSLNIRTAPLTKAQSHLSQKD
PNGTSSLPTGSSLLQELEVQNEEVAAFCQSIMKLKTKFPYTNHCTNPGYLLSPVTVQRNI
CGENASVKVSIEIEGFQLPVTFTCDVSSTVEIIIMQALCWVHDDLNQVDVGSYVLKVCGQ
EEVLQNNHCLGSHEHIQNCRKWDTEIKLQLLTFSAMCQNLARTAEDDEAPVDLNKYLYQI
EKPYKEVMTRHPVEELLDSYHNQVELALQMENQHRSVDQVIKAVRKICGALDGVETPAIT
EAVKKLKRAANLPRNKSAHVTSLSGGDISRNSARGSLNSENPVQVSMDQLTAAIYDLLRL
HANSSRSPVDSTQSSRGSREAWTTTEQLQFTVYAAHGISSTWVSNFEKYYLICSLSHNGK
DLFKPIQSKKVGTYKNFFYLIKWDELIIFPIQISQLPLESLLHLTLFGILNQSSGSSPDS
NKQRKGPEALGKVSLPLFDFKRLLMCGTKLLYLWTSSHTNSIPGTILRRGCVMERIVLQV
MVVLSKWTGLNLNVYRKLSKEDKVFLWEKRYYCLKHPNCLPKILASAPNWKWVHLAKIYS
LLHQWPPLCPLTALELLDSKFADQEVRSLAVSWIEAISDDELTDLLPQFVQALKYEIYLN
SSLVHFLLSRALGNIQIAHSLYWLLKDALHDTQFGSRYEHVLGALLSVGGKGLREELSKQ
MKLVQLLGGVAEKVRQASGSTRQVVLQRSMERVQSFFLRNKCRLPLKPSLVAKELNIKSC
SFFSSNAVPLKVTMVNADPLGEEINVMFKVGEDLRQDMLALQMIKIMDKIWLKEGLDLRM
VIFRCLSTGRDRGMVELVPASDTLRKIQVEYGVTGSFKDKPLAEWLRKYNPSEEEYEKAS
ENFIYSCAGCCVATYVLGICDRHNDNIMLRSTGHMFHIDFGKFLGHAQMFGSFKRDRAPF
VLTSDMAYVINGGERPTIRFQLFVDLCCQAYNLIRKQTNLFLNLLSLMIPSGLPELTSIQ
DLKYVRDALQPQTTDAEATIFFTRLIESSLGSIATKFNFFIHNLAQLRFSGLPSNDEPIL
SFSPKTYSFRQDGRIKEVSVFTYHKKYNPDKHYIYVVRILREGQLEPSFVFRTFDEFQEL
HNKLSIIFPLWKLPGFPNRMVLGRTHIKDVAAKRKIELNSYLQSLMSASTDVAECDLVCT
FFHPLLRDEKAEGIARSAGEGPFSPTPGQIGGAVKLSVSYRNGTLFIMVMHIKDLVTEDG
ADPNPYVKTYLLPDTHKTSKRKTKISRKTRNPTFNEMLVYSGYSKETLRQRELQLSVLSA
ESLRENFFLGGITLPLKDFNLSKETVKWYQLTAATYL
NT seq 4974 nt NT seq  +upstreamnt  +downstreamnt
atggctcagatttccaacaacagtgaatttaatcagtgttcatcttcacatctggaacca
atgcagacaaaagatgtggacaaagcagaagccttgcagatggaagcagaggccttagca
agactgcagaaggacaggcaggggactgatagccagagaggcttggagtggtccagcagt
acaagacaaagatcacaaggttttcatgcacaggagtatgatctcatggtgtttcctgaa
tctgattcccaaaagaaaggagtagatatcgatgtagaaaagctcacccaagccgagctt
gagaagttactgctggacgacacctttgagactagaaaagcccccatgttgccagttgct
cccgttgtcagcccttccttttcagcacagctctatctcagacctactgtagttcaaaga
ggacaatggccccctggattatctgggccttccacttacactttaccttctgtttatcct
tcagtttacagtaaacaggccacattccagaatggcttcaatccgaggatgcctactttt
ccatctacagaacctttatatttaagacttccaggacagtctccatacttttcatgtcct
ttgacacctggcacaccagttcatccacaaggaagcttacccatctatcggcctctagtc
agtcctgacatggcaaaactatttgacaaaatagcgagtacatccgaatttttaaaaaat
gggagagcaaggactgatttggagataacacattcacagccctcaatcagcagtctacag
gtatctccaaagactgaggacatcagtaaatttgactggttagacttggatcctctaagt
aagcccaagatggacagtgtggagttattagatctagaagaagagaaaaagatcccaagt
ttgctagcagaggacccttgggatgctgttcttcttgaagagaggtctccagcaagttgt
caactaggaagaaagtccaatggaacatccctttctggggcaactgtaaccaggagccag
tctttaaacattcggacagctccactaacaaaagcacagagccatctatctcagaaagac
ccaaatgggaccagtagtttgccaactggaagttctcttctacaagaacttgaagtacag
aatgaggaggtggcagctttttgtcaatccattatgaaactgaagaccaaatttccatat
accaatcactgcacaaatccaggctatttgttaagtccagtcacggtgcagagaaacata
tgtggagagaatgccagtgtgaaggtctctattgaaattgaaggatttcaactaccagtt
acttttacttgtgacgtgagttctactgtagaaatcatcatcatgcaagccctttgctgg
gtgcacgatgacttgaatcaagtagatgttggcagctatgttctgaaagtttgtgggcaa
gaggaggttctgcagaataatcactgccttggaagtcatgaacatattcaaaattgtcga
aaatgggacacagagattaaattacaactcttgaccttcagtgcaatgtgccagaatctg
gcccgaacagcagaagatgatgaagcacctgtggatttaaacaaatacttgtatcaaata
gaaaaaccttacaaagaagtcatgacaagacatcctgttgaagaactcttagattcttac
cacaaccaggtggagctggctcttcaaatggaaaaccagcaccgatctgttgatcaagtg
attaaagctgtaagaaaaatctgtggtgctctggatggagtggagacccctgccatcaca
gaggcagtgaagaagctgaagcgagcagctaacctgccaaggaataaaagtgctcatgtg
acttcgttatctggaggagatattagcaggaactcagccagaggctcactgaattctgaa
aatcctgttcaagtaagcatggaccagttaactgcagcaatttatgatcttctcaggctc
catgcaaattccagtaggagtcctgtagacagtacccagagtagcaggggcagtagggaa
gcgtggactacaacagaacagctccagttcactgtctatgctgcacacggaatttccagc
acctgggtatcaaattttgagaagtactatctgatatgctccctgtctcacaatgggaag
gatctttttaaacctatccagtcaaagaaggttggcacctacaagaatttcttctatctt
attaaatgggatgaactaatcatttttcctatccagatatcacagttgccattagaatca
cttcttcatcttactctgtttggaattttaaatcagagcagtggaagctcccctgattct
aataagcaaagaaagggaccagaggctttgggcaaagtttctttacctctttttgacttt
aaacggcttttaatgtgtggaactaaacttctgtatctttggacttcatcccatacaaat
tctattcctggaacaatcctcagaagaggatgtgtcatggagagaattgtgctacaggta
atggtggttctttccaaatggacgggcttaaatttaaatgtctatagaaagctttctaaa
gaagataaagtctttctgtgggagaaacgctactattgcctcaaacatccaaattgtctt
cctaaaatactagcaagtgccccaaactggaaatgggttcatcttgccaaaatttactca
ttgcttcaccagtggccgccattgtgtcccctgactgccttggagcttcttgattcaaaa
tttgccgatcaggaagtacgatccctagctgtgagctggatcgaggccattagtgatgat
gagctaacagatcttctcccccagtttgtacaggctttgaaatatgaaatttacttgaat
agttcattagtacacttccttctgtccagggcattgggaaatatccagatagcacacagt
ttgtattggcttctcaaggatgccctgcatgatacacagtttggaagcagatacgaacat
gtgctgggtgcgctcctctcagtaggaggaaaaggactcagagaagaactttctaagcag
atgaaacttgtacaactcttaggaggagtagcagaaaaagtaaggcaggctagtggatca
actagacaggttgtccttcaaaggagtatggagcgagtgcagtccttttttctgagaaac
aagtgccgtcttcctctcaaaccaagtctggtagcaaaagaattaaatatcaagtcctgt
tcattcttcagttctaatgctgtgcctctgaaagtcacaatggtcaatgctgatcctctg
ggggaagaaattaatgtcatgtttaaggtcggtgaagatctccggcaagatatgttagct
ttacagatgataaagattatggataagatctggcttaaagagggactggatctgaggatg
gtaatattcagatgtctgtcaactggccgagatcgaggcatggtggagctagttcctgct
tcagacacgctcaggaaaatccaagtggaatatggagtgacgggatcctttaaagataaa
ccacttgcagagtggctgaggaagtacaatccttctgaagaagaatatgaaaaggcttcc
gagaactttatctattcttgtgctggatgctgtgtagccacctacgtcttgggtatttgt
gaccgacacaatgacaacataatgctccgaagcacgggacacatgttccacattgacttt
ggaaagtttttgggccatgcccagatgtttggtagcttcaaaagggatcgagctcctttt
gtgcttacctctgacatggcgtatgtcatcaatggcggtgaaaggcccaccattcgtttc
cagttgtttgtggacctctgctgtcaagcctacaacttgataagaaagcaaacaaacctc
tttcttaacctcctttccctgatgattccttcagggttaccagaactcacaagcattcag
gatttgaaatatgttagagatgcattacagccccaaaccacagatgctgaggccacaatt
ttcttcactaggctgattgagtcaagtttgggtagcatcgccacgaagtttaacttcttc
attcacaaccttgctcagctgcgtttttctggcctgccttctaatgatgagcccatcctt
tcattttcaccaaaaacatactcttttagacaagatggtcgaatcaaggaagtctctgtt
ttcacatatcataagaaatacaacccagataaacattatatttatgtagtccgaatctta
agggaagggcagcttgaaccgtcctttgtattccggacatttgatgagtttcaggaactt
cacaataagctcagcatcattttcccactttggaagttacctggctttcctaataggatg
gtactaggaagaacacacataaaagatgtagcagccaaaaggaaaattgagttaaacagt
tatttacagagtttgatgagtgcgtcaacagatgtagcagagtgtgatcttgtttgtact
tttttccaccccttacttcgtgatgagaaggctgaaggaatagctaggtctgcaggtgaa
ggtcccttcagccctactccaggccagataggaggagcagtgaagctgtctgtctcgtac
cgaaatggcacccttttcatcatggtgatgcacatcaaagatctggttacagaagatggg
gctgacccaaatccatatgtcaaaacatacctacttccagatacccacaaaacgtctaaa
cgtaaaaccaaaatttcaagaaaaactaggaatccaacattcaatgaaatgcttgtgtac
agtggatatagcaaagaaaccttgaggcagagggaacttcagctgagtgtgctcagtgca
gagtctctgcgggagaatttcttcttgggtggaataactctacctttaaaagatttcaac
ttgagcaaagagacagttaagtggtatcagctgactgcagcaacttacctgtaa

DBGET integrated database retrieval system