KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103750910Help
Entry
103750910         CDS       T03372                                 

Gene name
Sept7
Definition
(RefSeq) septin 7
  KO
K16944  septin 7
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ngi04131]
    103750910 (Sept7)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ngi04812]
    103750910 (Sept7)
   04147 Exosome [BR:ngi04147]
    103750910 (Sept7)
Membrane trafficking [BR:ngi04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Septins
    103750910 (Sept7)
Cytoskeleton proteins [BR:ngi04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septins
    Group 2
     103750910 (Sept7)
Exosome [BR:ngi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   103750910 (Sept7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Septin MMR_HSR1 RsgA_GTPase AIG1 GTP_EFTU AAA_16 AAA_22 Ras FeoB_N ABC_tran AAA_29 Roc Gtr1_RagA Fez1
Motif
Other DBs
NCBI-GeneID: 103750910
NCBI-ProteinID: XP_008852417
Position
Un
AA seq 437 aa AA seqDB search
MSVSARSAAAEERSVNCSTMVAQPKNLEGYVGFANLPNQVYRKSVKRGFEFTLMVVGESG
LGKSTLINSLFLTDLYSPEYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDA
VDNSNCWQPVIDYIDSKFEDYLNAESRVNRRQMPDSRVQCCLYFIAPSGHGLKPLDIEFM
KRLHEKVNIIPLIAKADTLTPEECQQFKKQIMKEIQEHKIKIYEFPETDDEEENKLVKKI
KDRLPLAVVGSNTIIEVNGKRVRGRQYPWGVAEVENGEHCDFTILRNMLIRTHMQDLKDV
TNNVHYENYRSRKLAAVTYNGVDNNKNKGQLTKSPLAQMEEERREHVAKMKKMEMEMEQV
FEMKVKEKVQKLKDSEAELQRRHEQMKKNLEAQHKELEEKRRQFEEEKANWEAQQRILEQ
QNSSRTLEKNKKKGKIF
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtcagtgcgagatccgctgctgctgaggagaggagcgtcaactgcagcaccatg
gtagctcaaccgaagaaccttgaaggctatgtgggatttgccaatctcccaaatcaagtg
tatagaaaatcagtgaaaagagggtttgaattcacacttatggtagtaggtgaatctgga
ctgggaaagtcaacattaatcaactcattgttcctcacagatttgtattctccagagtat
ccaggtccctcccatagaataaaaaagactgtgcaggtggagcaatccaaagttttaatc
aaagaaggtggcgttcagttgctgctcacaatagttgataccccaggatttggagatgca
gtggataatagtaattgctggcagcctgttatcgactacattgatagtaaatttgaggat
tacttaaatgcagaatctcgagtgaacagacgtcagatgcctgatagcagggtgcagtgt
tgtttatacttcattgctccttcaggacatggacttaaacctttggatattgagtttatg
aaacgtttgcatgagaaagtgaatatcatcccactaattgccaaagcagacacactcaca
ccagaggaatgccaacagtttaaaaaacagataatgaaggaaatccaagagcataaaatt
aaaatatatgaatttccagaaacagatgatgaagaagaaaataagctggttaaaaagata
aaggaccgtttacctcttgctgtggtaggcagtaatactatcattgaagtcaatggcaaa
agggtcagaggaaggcagtatccttggggtgtggctgaagttgaaaatggtgaacattgt
gattttacaattctaagaaatatgttgataagaacacacatgcaagacttgaaagatgtt
actaataatgtacactatgagaactacagaagcagaaaactagcagctgtgacttacaat
ggagtggataacaacaagaataaagggcagcttacgaagagccctctggcacaaatggaa
gaagaaagaagagaacatgtagccaagatgaagaagatggagatggagatggaacaggtg
tttgaaatgaaggtcaaagaaaaagttcaaaaactgaaggactctgaagctgagctccag
cgacgccatgagcaaatgaaaaagaatttggaagctcaacacaaagaattagaggaaaaa
cgtcgacagtttgaggaagagaaagcaaactgggaagctcaacaacgtattttagaacag
cagaactcatcaagaaccttggaaaagaacaagaagaaaggcaagatcttttaa

DBGET integrated database retrieval system