KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103750935Help
Entry
103750935         CDS       T03372                                 

Gene name
Gba
Definition
(RefSeq) glucosylceramidase beta
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi00511  Other glycan degradation
ngi00600  Sphingolipid metabolism
ngi01100  Metabolic pathways
ngi04142  Lysosome
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    103750935 (Gba)
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    103750935 (Gba)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    103750935 (Gba)
Enzymes [BR:ngi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     103750935 (Gba)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C
Motif
Other DBs
NCBI-GeneID: 103750935
NCBI-ProteinID: XP_008852440
Position
Un
AA seq 536 aa AA seqDB search
MRLSRRPGKECLRHLGWVGVMAARLTGLFLLQAVSWASGARPCIPKSFGYSSVVCVCNAT
YCDSLDPLTLPAPGTFSRYESTRSGRRMELSVGSIQANRTGTGLLLTLQPEEKFQQVKGF
GGAMTDAAALNILALSPSAQNLLLKSYFSEEGIEYNIIRVPMASCDFSIRIYTYADTPND
YQLYNFSLPEEDTKLKIPLIHQALQMAQRPVSLFASPWTSPTWLKTNGAVNGKGSLKGQP
GDIYHQTWAKYFVKFLDAYAEHKLKFWAVTVENEPSAGLISGYPFQCLGFTAEHQRDFIA
RDLGPTLANSTHHNVQLLMLDDQRLLLPRWAQVVLADPEAAKYVHGIAVHWYLDFLAPAK
ATLGETHRLFPNTMLFASEACVGSKFWEQSVRLGSWDRGMQYSHSIITNLLYHVVGWTDW
NLALNPEGGPNWVRNFVDSPIIVDIAKDTFYKQPMFYHLGHFSKFIPEGSQRVGLVASEK
NDLDTVALIRPDGSAVVVVLNRSSKDVPLTISDPALGFLETISPGYSIHTYLWHRQ
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgaggctttcaagacgtccgggaaaggagtgtctcagacatctgggctgggtaggtgtc
atggctgccaggcttacaggattgttcctacttcaggcagtgtcatgggcatcaggtgcc
cggccctgcattcctaaaagctttggctatagctcagtggtctgtgtctgcaatgccacg
tactgtgactctcttgaccccctgaccctccctgctcccggtaccttcagccgctatgag
agtacacgaagtggacgacgaatggagctgagtgtggggtctatccaggccaatcgcaca
ggcacagggcttctactgaccctacagccagaagagaagtttcagcaagtgaaaggattt
ggaggagcaatgacagatgctgctgctctcaacatccttgccctgtcaccctctgcccag
aatctgctactcaaatcgtacttctctgaagaaggaattgaatataacatcatccgggta
cccatggccagctgtgacttctccattcgtatatacacttatgctgacacccctaatgac
taccagttatacaacttcagtcttccagaagaagataccaagctcaagatacccctgatt
caccaagccctgcagatggcccagcgccccgtctcactctttgccagtccctggacatca
cctacttggctcaagaccaatggggcagtgaatgggaaggggtcactcaagggtcagcca
ggggatatctatcaccagacctgggccaagtattttgtcaagtttctggatgcttatgct
gagcacaagttaaaattctgggcagtgacagtggagaatgagccttctgcggggctcatt
agtgggtaccccttccagtgcctaggcttcactgctgaacaccagcgagacttcattgcc
cgtgacctaggaccaaccctagccaacagtactcaccataatgtccagttgctcatgtta
gatgatcagcgcttgctactgccccgctgggcacaggtggtgttggcagacccagaagca
gctaagtacgttcatggcattgctgtgcactggtacctggactttctggctccagcaaaa
gccactctaggagagacacaccgcctcttccctaacaccatgctttttgcctcagaggcc
tgtgtgggttccaagttctgggaacagagtgtgcgtttgggctcctgggatcgagggatg
cagtacagtcacagcatcatcacgaacctcctttaccatgtggttggctggactgactgg
aaccttgccctgaatcctgaaggggggcccaactgggtccgaaactttgttgacagtccc
atcattgtagacattgccaaagatacattttacaaacagcccatgttctaccatcttggc
cacttcagcaaattcattcctgagggatcccagagagtggggctggtggccagtgagaag
aacgatctagacacagtggcactgatacgccctgatggctctgcagttgtggttgtccta
aaccgctcctctaaggatgtccctcttacgatcagtgatcctgctctgggattcctggag
accatctcacctggctactccattcatacctacctgtggcatcgccagtga

DBGET integrated database retrieval system