KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103752021Help
Entry
103752021         CDS       T03372                                 

Gene name
Camkk1
Definition
(RefSeq) calcium/calmodulin dependent protein kinase kinase 1
  KO
K00908  calcium/calmodulin-dependent protein kinase kinase 1 [EC:2.7.11.17]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09160 Human Diseases
  09165 Substance dependence
   05034 Alcoholism
    103752021 (Camkk1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ngi01001]
    103752021 (Camkk1)
Enzymes [BR:ngi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     103752021 (Camkk1)
Protein kinases [BR:ngi01001]
 Serine/threonine kinases: Other
  CAMKK family
   103752021 (Camkk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 103752021
NCBI-ProteinID: XP_017650474
Position
Un
AA seq 520 aa AA seqDB search
MEGGPAVCCQDPRAELVERVAAIDVAHLEEAEEGPEPARNGVDPLPRARAASVIPSSASR
PLPARPSLSARKFSLQERTSGSCLEAKAGPYSTGPASHISPRAWRRPTIESHHVAISDAE
DCVQLNQYKLQSEIGKGAYGVVRLAYNESEDRHYAMKVLSKKKLLKQYGFPRRPPPRGSQ
AAQGGPAKQLLPLERVYQEIAILKKLDHVNVVKLIEVLDDPAEDNLYLVFDLLRKGPVME
VPCDKPFPEEQARLYLRDIILGLEYSLSLCKRCGWMESVSSCLQKIVHRDIKPSNLLLGD
DGHVKIADFGVSNQFEGNDAQLSSTAGTPAFMAPEAISDSGQSFSGKALDVWATGVTLYC
FVYGKCPFIDEYILALHRKIKNEAVVFPEEPEVSEELKDLILKMLDKNPETRIGVPDIKL
HPWVTKHGEESLPSEEEHCSMVEVTEEEVKNSVKLIPSWTTVILVKSMLRKRSFGNPFEP
QTRREERSMSAPGNLLVKQGCGEGSKSPELPGVQEDETAS
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atggagggtggcccggctgtctgctgccaggatcctcgagcagagttggtagaacgggta
gcagccatcgatgtggcccacttggaagaggcagaagaaggcccagagcctgccaggaat
ggtgtggaccctctaccccgagccagagctgcctctgtgatccctagcagtgcttcaaga
cccctcccagcacggcccagcctctcggccagaaagttctccctgcaggaacggacttct
ggaagctgtcttgaggccaaggctgggccttattctacaggacctgccagccatatctcc
cctcgggcctggcggaggcccaccattgagtcccaccatgtagccatctcagatgcagag
gactgtgtgcagctgaaccagtacaagctacagagtgagattggcaagggtgcctacggc
gtggtgaggctggcctataatgaaagtgaagacagacactatgcaatgaaagttctttcc
aaaaagaagttactgaagcagtatggctttccccgtcgtcctcccccaagagggtctcaa
gctgcccagggagggccggccaagcaactgttgcccttggagcgtgtataccaggagatc
gccattttgaagaagctggaccacgtgaatgtagtcaaactgattgaggtcctggatgac
cctgctgaggacaatctctatttggtgtttgacctcctgagaaagggaccagtcatggaa
gtgccttgtgacaagcctttcccagaggagcaagctcgcctctacctgcgggacatcatc
ctgggcctggagtactctttgtcactctgcaagagatgtgggtggatggagtctgtgtcc
agctgcttgcagaagattgtccacagggacatcaagccatccaatctgctcctgggggat
gatgggcatgtgaagattgccgattttggtgtcagcaaccagtttgaggggaatgacgct
cagctgtccagcacagcggggaccccagcattcatggcccctgaggccatttctgattct
ggccagagcttcagtgggaaggccttggatgtgtgggccactggggtcacgctgtactgt
tttgtctatgggaagtgcccattcattgatgagtacatcctggccctgcacaggaagata
aaaaatgaggccgtggtgttccctgaggagccagaggtcagcgaggagctcaaggacctc
atcctgaagatgctagacaaaaatcctgaaacaagaattggggtaccagacatcaagtta
cacccttgggtgaccaagcatggggaggagtccctcccttcagaggaggagcattgtagt
atggtagaggtgacggaggaggaggtgaagaactcagtcaagctcatccccagctggacc
acagtgattctagtcaagtccatgctgagaaagcgttcctttggcaacccatttgagccc
cagacacgcagggaagagcgatccatgtctgctccaggaaacttactggtgaaacaaggg
tgtggtgaagggagcaaaagcccagagctccctggagtccaggaagatgagactgcatcc
tga

DBGET integrated database retrieval system