KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 108490354Help
Entry
108490354         CDS       T03372                                 

Definition
(RefSeq) glutathione S-transferase theta-1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi00480  Glutathione metabolism
ngi00980  Metabolism of xenobiotics by cytochrome P450
ngi00982  Drug metabolism - cytochrome P450
ngi00983  Drug metabolism - other enzymes
ngi01100  Metabolic pathways
ngi01524  Platinum drug resistance
ngi05200  Pathways in cancer
ngi05204  Chemical carcinogenesis
ngi05225  Hepatocellular carcinoma
ngi05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    108490354
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    108490354
   00982 Drug metabolism - cytochrome P450
    108490354
   00983 Drug metabolism - other enzymes
    108490354
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108490354
   05204 Chemical carcinogenesis
    108490354
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    108490354
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108490354
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    108490354
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ngi02000]
    108490354
Enzymes [BR:ngi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     108490354
Transporters [BR:ngi02000]
 Other transporters
  Pores ion channels [TC:1]
   108490354
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_C_2 GST_C
Motif
Other DBs
NCBI-GeneID: 108490354
NCBI-ProteinID: XP_017651914
Position
Un
AA seq 65 aa AA seqDB search
MFPVFLGEQIPPDVLAATLAELDANLQLLEHKFLQDKAFLTGSHISPADLVAITELIHPV
GGGCQ
NT seq 195 nt NT seq  +upstreamnt  +downstreamnt
atgttccctgttttcctgggtgagcaaataccccctgatgtgctggcagccacactggca
gaattggatgctaacctgcagttgctcgagcacaagtttctccaggacaaggctttcctt
actgggtcccacatctcccctgctgacctggtagccattacagagctgatacatcctgta
ggtggtggctgccaa

DBGET integrated database retrieval system