KEGG   Neisseria gonorrhoeae NCCP11945: NGK_0383Help
Entry
NGK_0383          CDS       T00728                                 

Definition
(GenBank) TrpA
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ngk  Neisseria gonorrhoeae NCCP11945
Pathway
ngk00260  Glycine, serine and threonine metabolism
ngk00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ngk01100  Metabolic pathways
ngk01110  Biosynthesis of secondary metabolites
ngk01130  Biosynthesis of antibiotics
ngk01230  Biosynthesis of amino acids
Module
ngk_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ngk00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NGK_0383
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NGK_0383
Enzymes [BR:ngk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     NGK_0383
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB His_biosynth ZnuA ALF
Motif
Other DBs
NCBI-ProteinID: ACF29076
UniProt: B4RJS3
Position
317968..318795
Genome map
AA seq 275 aa AA seqDB search
MYFTAYLPIGWKRQMSRIRQAFAALDGGKALIPYIAVGDPDIRTTLALMHGMVASGADIL
ELGVPFSDPMADGPVIQRAAERALANGISLRDVLDVVRKFRETDTQTPVVLMGYLNPIHK
MGYREFAQEAAKAGVDGVLTVDSPIETIGSLYRELKDNEVDCIFLIAPTTTEDRIKTIAE
LAGGFVYYVSLKGVTGAASLDTDEVSRKIEYLRQYIDIPIGVGFGISNAESARKIGRVAD
AIIVGSRIVKEIENNAGNEAAAVGALVKELKDAVR
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
ttgtattttacggcgtatttgccgataggatggaagagacaaatgagcagaatccggcag
gcttttgccgctttggatggcggaaaggcattgattccctatattgcggtgggcgacccc
gatattcggacaactttggcattgatgcacggcatggttgcaagcggtgcggatattttg
gagttgggcgtgccgttttccgatccgatggcggacgggccggttattcagcgtgcggcg
gagcgggcgttggcaaacgggatttcgctgcgcgatgtcttggatgtcgtcagaaaattc
cgtgaaaccgacacgcaaacgccggttgttttgatgggatatttgaatcccatacataag
atgggttatcgggagtttgctcaggaagccgcaaaggcgggggtggacggcgtgttgacg
gtggattcccccatcgaaaccatcggttctttatatcgcgagctgaaggataacgaggtc
gactgtattttcctgattgcgccgacgacgacggaagaccgtattaaaaccattgccgag
ctggcaggcggatttgtctattatgtttcgctcaagggcgtaacgggcgcggcaagtttg
gatacggatgaggtttcgcgtaaaatagagtatttgcgtcagtatatcgatattcccatc
ggtgtcggtttcggcatcagcaatgcggaaagcgcgcgcaaaatcggccgggttgccgac
gcgatcattgtcggcagccggattgtgaaagagattgaaaacaatgcgggcaacgaggct
gccgccgtcggtgctttggtcaaagagttaaaggatgccgtgcgctga

DBGET integrated database retrieval system