KEGG   Neisseria gonorrhoeae NCCP11945: NGK_0685Help
Entry
NGK_0685          CDS       T00728                                 

Definition
(GenBank) putative isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
ngk  Neisseria gonorrhoeae NCCP11945
Pathway
ngk00020  Citrate cycle (TCA cycle)
ngk00480  Glutathione metabolism
ngk01100  Metabolic pathways
ngk01110  Biosynthesis of secondary metabolites
ngk01120  Microbial metabolism in diverse environments
ngk01130  Biosynthesis of antibiotics
ngk01200  Carbon metabolism
ngk01210  2-Oxocarboxylic acid metabolism
ngk01230  Biosynthesis of amino acids
Module
ngk_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ngk_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:ngk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NGK_0685
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    NGK_0685
Enzymes [BR:ngk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     NGK_0685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: ACF29368
UniProt: B4RKM5
Position
complement(563146..565371)
Genome map
AA seq 741 aa AA seqDB search
MTQKSTIVYTHTDEAPALATQSLLPIVQAFARHADIDVKTADISLSGRILAAFPEYLTEA
QRVPDALAELGELVKQPGANVIKLPNISASVPQLTAAIKELQSKGFAVPDYPADPQTDEE
KAVRERYDRIKGSAVNPVLREGNSDRRAPKAVKNFAKKNPHSMGAWAKDSKTHVATMQSG
DFFHNEQSVTVPDATSVSIVFTDKQGNKKELREPVALKAGEIIDAAVMSKKALLAFLAEQ
VKDAKAKGVLFSLHMKATMMKVSDPIIFGHAVKVFFAPVFEKFGGKLAAAGVNVNNGFGN
LIANLDKLDADTRAAVEAEIAAVYAANPDLAMVDSDKGITNLHVPSDVIVDASMPAMIRN
SGRMWDKNGKAQDTKAVIPDSSYAGVYQATIDFCREHGAFDPTTMGTVPNVGLMAQAAEE
YGSHNKTFEIEADGQVQVIDAAGNVLMQHDVEAGGIWRMCQTKDAPVKDWVQLAVNRARL
SNTPAVFWLDENRPHDKSLLAKVKAYLAELDTNGLDIRVLAPEEAAKFSLGRLKNGEDTI
SVTGNVLRDYLTDLFPILELGTSAKMLSIVPLMNGGGMFETGAGGSAPKHVQQFLEENHL
RWDSLGEFLALAVSFEHLAQKTGNAKAQVLADTLDAATEKLLLNDKSPKRKAGELDNRGS
HFYLTLYWAQELAAQDKDAELKAAFAPLAAALTADEAKIVEELSAVQGKAVDIGGYYAAN
PEKAAQAMRPSATFNQVLNAL
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atgactcaaaaatccaccattgtttatacccataccgacgaagcccccgcgctggcgacc
caatcgctgctgccgattgtgcaggcgtttgcccgccacgccgatattgatgtcaaaact
gccgacatttccctgtccggccgcattttggcggcattccccgaatatctgaccgaagcg
cagcgcgtacccgacgcgcttgccgaattgggcgaactggtgaaacaacccggtgcaaac
gtaatcaaactgccgaacatcagcgcatccgtacctcaactgaccgccgcgattaaagaa
ttgcagtctaaaggctttgccgttcccgactatcctgccgaccctcaaaccgatgaagaa
aaagccgtacgcgaacgctacgaccgcatcaaaggcagcgcggtaaaccctgtcctgcgc
gaaggcaactccgaccgccgcgcgcctaaagcggtgaaaaactttgccaaaaaaaatccg
cacagcatgggcgcgtgggcgaaagactccaaaacccacgttgccaccatgcaaagcggc
gactttttccataacgaacaatccgttaccgtacccgatgcgacttccgtatccatcgtg
ttcaccgacaaacaaggcaataaaaaagagctgcgcgagcctgttgccctgaaagccggc
gaaatcattgacgcggccgtaatgagcaaaaaagccctgctcgccttccttgccgaacaa
gtgaaagacgcaaaagctaaaggcgtattgttctcgctgcatatgaaagccacgatgatg
aaagtgtccgacccgattatcttcggacacgccgtcaaagtgttcttcgcgcctgtattt
gaaaaattcggcggcaaactggctgccgcaggcgtcaacgtcaacaacggcttcggcaac
ctgattgccaatctggacaagctggatgcggacacccgcgccgccgtcgaagctgaaatc
gccgccgtttacgccgccaaccctgatttggcgatggtcgattccgacaaaggcatcacc
aacctgcacgttcccagcgatgtcatcgttgatgcttctatgcctgcgatgatccgcaat
tccggccgtatgtgggacaaaaacggcaaagcgcaagacaccaaagccgtgattcccgac
agcagctatgccggtgtttaccaagcaaccatcgatttctgccgcgaacacggcgcattc
gatccgacaacaatgggtactgtgcccaacgtcggactgatggcgcaagcggcggaagaa
tacggctcacacaacaaaacctttgaaatcgaagccgacggtcaggttcaagtgattgat
gcggcgggcaatgtcctgatgcagcacgacgttgaggcaggcggcatctggcgcatgtgc
caaaccaaagacgctcccgtcaaagactgggtacaactcgccgtcaaccgcgcccgcctg
agcaacacgcccgccgtgttctggctcgacgaaaaccgtccgcacgacaagagtctgctc
gccaaagtcaaagcctaccttgccgaattggataccaacggcctcgacatccgcgtcctc
gcgcccgaagaagccgctaaattcagcttgggccgtctgaaaaacggcgaagacaccatt
tccgtaaccggcaacgtcctgcgcgattatctgaccgacttgttcccgattttggaactg
ggtaccagcgcgaaaatgctgtccatcgttccattgatgaacggcggcggtatgtttgaa
accggcgcgggcggttctgcaccgaaacacgtccaacagttcctcgaagaaaaccacctg
cgttgggactcattgggcgaattcctcgcgcttgccgtatcgtttgaacatctggcgcaa
aaaaccggcaacgccaaagcccaagtcctcgccgacactttggatgccgccaccgaaaaa
ctgctgttgaacgacaaatcgcccaaacgcaaagcgggcgaactcgacaaccgcggcagc
catttctacctcaccctctactgggcgcaagaattggcggcgcaagacaaagatgccgaa
ctgaaagccgcatttgctccattggcagccgctttgactgccgacgaagccaaaatcgtt
gaagaactctctgccgtacaaggcaaagcggtcgacatcggcggctactacgcagccaat
cctgaaaaagccgcacaagcgatgcgtccgagcgcaacctttaatcaagtactaaacgcc
ttataa

DBGET integrated database retrieval system