KEGG   Neisseria gonorrhoeae NCCP11945: NGK_1217Help
Entry
NGK_1217          CDS       T00728                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
ngk  Neisseria gonorrhoeae NCCP11945
Pathway
ngk00260  Glycine, serine and threonine metabolism
ngk00750  Vitamin B6 metabolism
ngk01100  Metabolic pathways
ngk01110  Biosynthesis of secondary metabolites
ngk01120  Microbial metabolism in diverse environments
ngk01230  Biosynthesis of amino acids
Module
ngk_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ngk00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NGK_1217
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    NGK_1217
Enzymes [BR:ngk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     NGK_1217
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: ACF29894
UniProt: B4RM57
Position
991918..993384
Genome map
AA seq 488 aa AA seqDB search
MRQMPSESVFLQFRQTRKIMRYISTRGETAHKPFSEVLLMGLAPDGGLMLPEHYPQIGRE
TLDKWRGLAYPELAFEIMCLFVTDIPEDDLRDILNRTYTEAAFGTKEITPVRTLSDGIKI
QALSNGPTLAFKDMAMQFLGNAFEYVLNKEGKKLNILGATSGDTGSAAEYALRGKKGVNV
FMLSPDGKMSAFQRAQMYSLQDGNIHNIAVKGMFDDCQDIVKAVQNDAAFKEKYHIGTVN
SINWGRIVAQVVYYFAGYFNATSSNDETVSFCVPSGNFGNVCAGHIAKQMGLPVRCLIVA
TNENDVLDEFFKTGAYRPRNSAHTYVTSSPSMDISKASNFERFVFDLMDRDPQEINTLWA
EVAAGKGFDLRFALDKVGGKYGFTSGKSTHADRLATIRQVYEQDKELIDPHTANGVKVAR
EVREAGETVVCLETALAAKFDATIREAVGDVAIPRPAALEGLENLPQRVQTVPNSADAVK
GIIEQTLA
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgaggcagatgccgtctgaatccgttttcctgcaatttcgacaaacgagaaaaatcatg
agatacatcagcacgcgcggcgaaaccgcacacaaaccgttcagcgaagttttattgatg
gggcttgcacccgacggcggactgatgctgccggaacattatccgcaaatcgggcgcgaa
accttggacaaatggcgcggtttggcttatcccgaattggcgtttgaaatcatgtgcctg
ttcgttaccgatattccggaggacgatttgcgcgacattctgaaccgtacttacacggaa
gcggcgttcggtactaaggaaatcacccccgtccgcacgctttcagacggcatcaaaatc
caagccttgtccaacggcccgacgctggcgttcaaagatatggcgatgcagtttttgggc
aatgcgtttgaatatgttttaaacaaagaaggcaaaaaactcaatatcttgggcgcaacc
agcggcgatacgggttcggctgcggaatatgccttgcgcggcaaaaaaggcgtgaacgta
tttatgttgtcgcccgacggtaaaatgagcgcgttccaacgcgcgcagatgtacagcctg
caagacgggaatatccacaatatcgccgtgaaggggatgtttgacgactgccaggacatt
gtgaaggcagtgcagaacgatgccgcgttcaaggaaaaataccatatcggtacggtcaat
tcgatcaactgggggcgcatcgtcgcgcaagtggtttattactttgcaggctatttcaat
gccacttcaagcaatgacgaaaccgtcagcttttgcgtaccgagcggcaacttcggcaac
gtttgcgcgggacacatcgccaaacaaatgggcctgcctgtccgctgcctgattgtcgcg
accaatgaaaacgatgtgctggacgagtttttcaaaaccggcgcataccgcccgcgcaac
agcgcgcatacttatgtaacctccagcccgtctatggacatttccaaagcgtccaacttc
gagcgtttcgtgttcgacctgatggatcgcgatcctcaggaaatcaatacgctgtgggcg
gaagtcgcggcaggcaaaggctttgacctgcggtttgccttggacaaagtcggcggcaaa
tacggctttacctccggcaaatctacccacgccgaccgcctcgccaccatcagacaggtt
tacgagcaagacaaagaactcatcgacccgcatactgccaacggcgtaaaagtcgcccgc
gaagtgcgcgaagcgggggaaacggtggtttgtttggaaaccgcgttggcggcgaaattc
gatgcgaccatacgcgaagccgtcggcgatgtcgccattccgcgccccgccgcgctggaa
ggtttggaaaacctgccgcagcgcgtgcaaaccgtgccgaacagtgcggatgcggtaaaa
ggcatcatcgaacaaacccttgcctga

DBGET integrated database retrieval system