KEGG   Neisseria gonorrhoeae NCCP11945: NGK_1316Help
Entry
NGK_1316          CDS       T00728                                 

Definition
(GenBank) alcohol dehydrogenase class-III
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
ngk  Neisseria gonorrhoeae NCCP11945
Pathway
ngk00010  Glycolysis / Gluconeogenesis
ngk00071  Fatty acid degradation
ngk00350  Tyrosine metabolism
ngk00625  Chloroalkane and chloroalkene degradation
ngk00626  Naphthalene degradation
ngk00680  Methane metabolism
ngk01100  Metabolic pathways
ngk01110  Biosynthesis of secondary metabolites
ngk01120  Microbial metabolism in diverse environments
ngk01130  Biosynthesis of antibiotics
ngk01200  Carbon metabolism
ngk01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ngk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NGK_1316
  09102 Energy metabolism
   00680 Methane metabolism
    NGK_1316
  09103 Lipid metabolism
   00071 Fatty acid degradation
    NGK_1316
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    NGK_1316
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    NGK_1316
   00626 Naphthalene degradation
    NGK_1316
Enzymes [BR:ngk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     NGK_1316
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     NGK_1316
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N TrkA_N 2-Hacid_dh_C Met_10 MinC_C CLLAC
Motif
Other DBs
NCBI-ProteinID: ACF29991
UniProt: B4RMF6
Position
1084692..1085042
Genome map
AA seq 116 aa AA seqDB search
MPDGTTRFSYQGQPIYHYMGCSTFSEYSVVAEVSLAKINPKANHEQVCLLGCGVTTGIGA
VHNTAKVQEGDSVAVFGLGAIGLAVVQGARQAKAGRIIAIDTNPAKFELAKQCWCN
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atgccagacggcacgacgcgtttttcttatcaaggtcagccgatttatcactatatgggc
tgttcgactttcagtgaatattctgttgttgccgaagtttcactggcgaaaatcaacccg
aaagccaaccacgaacaagtatgtttgctcggctgcggcgttaccactggtattggtgcg
gtacataacacggcaaaagtacaagaaggcgattctgttgccgtgtttggcttgggagcg
attggtttggctgtggtgcaaggtgcgcgtcaagccaaagccggtcgcattatcgccatt
gataccaatcctgcaaaattcgagttggcaaaacagtgttggtgcaactga

DBGET integrated database retrieval system