KEGG   Neisseria gonorrhoeae NCCP11945: NGK_1531Help
Entry
NGK_1531          CDS       T00728                                 

Definition
(GenBank) KguA
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
ngk  Neisseria gonorrhoeae NCCP11945
Pathway
ngk00230  Purine metabolism
ngk01100  Metabolic pathways
Module
ngk_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ngk00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    NGK_1531
Enzymes [BR:ngk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     NGK_1531
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_16 AAA_33 cobW MobB AAA_18 AAA_22 AAA_28 AAA_25 CbiA RsgA_GTPase NTPase_1 ArgK MMR_HSR1 AAA_19 Thymidylate_kin
Motif
Other DBs
NCBI-ProteinID: ACF30188
UniProt: B4RN21
Position
complement(1272738..1273379)
Genome map
AA seq 213 aa AA seqDB search
MENIQVKNMSAYRKGNIFIISAASGTGKTTLVSRLLANHNGLRVSVSHTTRPPREGEANG
VHYHFVSKEEFESLIAQEAFLEYADVFGNYYGTSTEGVNALAAAGYDVILEIDVQGAAQV
RNALPEAVGIFILPPSFDVLAARLKGRGTDSREVIQRRLSKARHEIEQSVLFDFVVVNDD
LEKAEGDLLHIVNACRLKRSRQLGFIADLLENS
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaatatacaggtaaaaaatatgtccgcttatcgaaaaggcaacatctttatcatt
tcggccgcttccggcacgggcaaaaccacgctggtgtcgcggctgttggcaaaccataac
ggtttgcgcgtttccgtgtcgcatacgacgcgcccgccgcgtgaaggcgaagcaaacggc
gtacattatcactttgtttccaaagaagagtttgaatcgcttatcgcgcaggaggctttt
ttggaatacgcagacgtattcggcaactattacggcacaagcacggagggcgtgaatgcg
ttggcggcggcaggctatgacgtgattttggaaatcgacgttcagggcgcggcgcaggtt
cgcaacgcgctgccggaagctgtcggtatctttatcctgccgccttctttcgacgtgctt
gccgcgcgcctcaaagggcgcgggacggacagtcgggaagttatccaaaggaggctgtcg
aaggcaaggcatgaaatcgaacagtccgtattgttcgactttgtcgtggtcaatgacgac
ctggagaaggcggagggggatttgcttcatattgtgaatgcctgccgtctgaaaaggtcg
cggcaactgggatttattgcagatttgttggaaaattcctaa

DBGET integrated database retrieval system