KEGG   Neisseria gonorrhoeae NCCP11945: NGK_2470
Entry
NGK_2470          CDS       T00728                                 

Definition
(GenBank) (3R)-hydroxymyristoyl-(acyl carrier protein) dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
ngk  Neisseria gonorrhoeae NCCP11945
Pathway
ngk00061  Fatty acid biosynthesis
ngk00780  Biotin metabolism
ngk01100  Metabolic pathways
ngk01212  Fatty acid metabolism
Module
ngk_M00083  Fatty acid biosynthesis, elongation
ngk_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:ngk00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    NGK_2470
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    NGK_2470
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ngk01004]
    NGK_2470
Enzymes [BR:ngk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     NGK_2470
Lipid biosynthesis proteins [BR:ngk01004]
 Fatty acid synthase
  Component type
   NGK_2470
SSDB
Motif
Pfam: FabA 4HBT MaoC_dehydratas
Other DBs
NCBI-ProteinID: ACF31070
UniProt: B4RR12
Position
complement(2061001..2061450)
AA seq 149 aa
MDVQLPIEAKDIQKLIPHRYPFLQLDRITAFEPMKTLTAIKNVTINEPQFQGHFPDLPVM
PGVLIIEAMAQACGTLAILSEGGRKENEFFFFAGIDEARFKRQVIPGDQLVFEVELLTSR
RGIGKFNAVAKVDGQVAVEAVIMCAKRVV
NT seq 450 nt   +upstreamnt  +downstreamnt
atggacgtacaactccccatcgaagccaaagacatccaaaaactcatcccccaccgctac
ccgtttctccagctcgaccgcattaccgccttcgagccgatgaaaaccctgaccgccatc
aaaaacgtaaccataaacgaaccccaattccaaggccatttccccgacctgcccgttatg
cccggcgtactcatcatcgaagcgatggcgcaggcgtgcggcacgttggcgattttgagc
gaaggcgggcgcaaggaaaacgaatttttcttcttcgccggcatagacgaagcccgtttc
aaacgccaagtcatccccggcgaccaactcgtctttgaagtcgaactcctgaccagccgg
cgcggcatcggcaaattcaacgccgttgccaaagtggacggacaagtcgccgtcgaagcc
gtgattatgtgcgccaaacgcgtggtttga

DBGET integrated database retrieval system