KEGG   Neisseria gonorrhoeae NCCP11945: NGK_2616Help
Entry
NGK_2616          CDS       T00728                                 

Definition
(GenBank) Probable aromatic acid decarboxylase
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
ngk  Neisseria gonorrhoeae NCCP11945
Pathway
ngk00130  Ubiquinone and other terpenoid-quinone biosynthesis
ngk01100  Metabolic pathways
ngk01110  Biosynthesis of secondary metabolites
ngk01120  Microbial metabolism in diverse environments
ngk01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ngk00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    NGK_2616
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    NGK_2616
Enzymes [BR:ngk01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     NGK_2616
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-ProteinID: ACF31215
UniProt: B4RJE9
Position
complement(2196790..2197347)
Genome map
AA seq 185 aa AA seqDB search
MIIGISGASGFQYGVKALELLRAQDVETHLVVSKGAEMARASETDYTKDEVYALADFVHP
IGNIGACIASGTFKTDGMLVAPCSMRTLASVAHGFGDNLLTRAADVVLKERRRLVLMVRE
TPLNLAHLDNMKRVTEMGGVVFPPVPAMYRKPQTADDIVAHSIAHTLSLFGIDTPDLAEW
QGMAD
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
ttgataatcggcatcagcggggcgagcggtttccaatacggcgtgaaggctttggaactt
ttgcgcgcgcaagatgtcgaaacgcaccttgtggtatcgaaaggcgcggagatggcgcgc
gcttcggaaacggattatacgaaagacgaagtatatgccttggctgatttcgtccatccg
atcggcaatatcggggcgtgcattgccagcggtacgtttaaaacggacgggatgctggtc
gcaccctgttcgatgcggacgcttgcctctgtcgcgcacggcttcggcgacaatctcttg
acgcgtgcggcggatgtggttttgaaggaaaggcggcggctggtgctgatggtgcgcgaa
acgccgctgaaccttgcccatttggacaatatgaagcgggtaacggaaatgggcggcgtg
gtgtttccccctgttcctgcgatgtaccgcaagccgcagacggcggacgacatagtggcg
cacagtatcgcacacacgctgtcgctgttcggaatcgatacgccggatttggcggaatgg
cagggaatggcggattaa

DBGET integrated database retrieval system