KEGG   Neisseria gonorrhoeae NCCP11945: NGK_2628Help
Entry
NGK_2628          CDS       T00728                                 

Definition
(GenBank) glycyl-tRNA synthetase alpha subunit
  KO
K01878  glycyl-tRNA synthetase alpha chain [EC:6.1.1.14]
Organism
ngk  Neisseria gonorrhoeae NCCP11945
Pathway
ngk00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:ngk00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    NGK_2628
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ngk01007]
    NGK_2628
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ngk03016]
    NGK_2628
Enzymes [BR:ngk01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     NGK_2628
Amino acid related enzymes [BR:ngk01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   NGK_2628
Transfer RNA biogenesis [BR:ngk03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    NGK_2628
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2e
Motif
Other DBs
NCBI-ProteinID: ACF31227
UniProt: B4RJG2
Position
2206130..2207026
Genome map
AA seq 298 aa AA seqDB search
MLTFQQIIFKLQTFWADKGCTVIQPFDMEVGAGTSHPATCLRALGPEPWFAAYVQPSRRP
KDGRYGDNPNRLQHYYQFQVALKPAPANIQDLYLDSLRELGIDPKVHDIRFVEDDWENPT
LGAWGLGWEVWLNGMEVTQFTYFQQVGGIDCTPVLGEITYGIERLAMYLQGVENVYDLVW
AKTPDGNTVSYGDVYHQNEVEQSTYNFEYSDADWLLRQFNDYEAQAKRLFAEENADLALP
AYELVLKAGHTFNLLDARGAISVTERATYIGRIRALSRAVAQKYIESREKLGFPLIKK
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgcttaccttccaacaaatcatcttcaaactgcaaaccttctgggcagacaaaggctgc
accgtcatccaacccttcgacatggaagtcggtgccggcacatcccatcccgccacctgc
ctgcgcgcgctcggccccgagccttggtttgccgcctacgtccaacccagccgccgcccc
aaagacggccgctacggcgacaaccccaaccgcctgcaacactattaccaattccaagtc
gccctcaaacccgcccccgccaatatccaagacctctatctcgactccctgcgcgaattg
ggcatcgatcccaaagtccacgacatccgctttgtcgaagacgactgggaaaaccccacc
ctcggtgcgtggggtttgggctgggaagtctggctcaacggcatggaagtaacccagttt
acctatttccaacaagtcggcggtatcgattgcacgcccgtactcggcgaaattacctac
ggcatcgaacgcttggcgatgtacctgcaaggcgtggaaaacgtctatgacctcgtttgg
gcaaaaacgccggacggcaataccgtaagctacggcgacgtgtaccatcaaaacgaagtc
gagcaatctacctacaacttcgaatacagcgatgccgactggctgctgcgccagttcaac
gactacgaagcgcaagccaaacgcctgttcgccgaagaaaacgccgaccttgccttacct
gcctacgagctggtcctcaaagcggggcatacgttcaaccttttagacgcacgcggcgcg
atttccgtaaccgagcgggcaacttatattggacgtattcgtgcattgagccgcgccgtg
gcgcaaaaatatatcgaaagccgtgagaaactgggcttcccgttgattaaaaaataa

DBGET integrated database retrieval system