KEGG   Neorhizobium galegae bv. officinalis bv. officinalis HAMBI 1141: RG1141_CH31730Help
Entry
RG1141_CH31730    CDS       T03208                                 

Definition
(GenBank) Amidase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
ngl  Neorhizobium galegae bv. officinalis bv. officinalis HAMBI 1141
Pathway
ngl00970  Aminoacyl-tRNA biosynthesis
ngl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ngl00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    RG1141_CH31730
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ngl03029]
    RG1141_CH31730
Enzymes [BR:ngl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     RG1141_CH31730
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     RG1141_CH31730
Mitochondrial biogenesis [BR:ngl03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    RG1141_CH31730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: CDN55508
UniProt: A0A068TAP4
Position
complement(3139045..3140439)
Genome map
AA seq 464 aa AA seqDB search
MNDLLKLTIRELLDLYSTRKLSPLEYWLAVEDRIAAFEPHVQALYLYDPESARAQAAAST
DRWMKGATKGVLDGIPVTLKELIATKGQPVPLGTAAVELVPAAEDAPIAARMREDGAVIF
AKTTCPDYGMLSSGLSSFHHLSRNPWDLTQNPGGSSAGASAAGAAGFGPLHIGTDIGGSV
RLPAGWTGLFGFKPSQGRIPVDPYYVGRCAGPMTRTVEDAAFSMATLSRPDWRDGTSLPP
NDFDWLNFDIDVKGMKIGLMLDAGIGLAVEDEVRDAVVAAAKRFEDAGAIIIPVEPVMNR
IMLDGLDSFWRSRFWGDIEKMPEERRALILPYIYQWAEGGTYISGVEAVRGFNQTIEMRK
ACGRLFTTVDAVISPTNPIVSYPAEWASPTNDPALPFEHIGFTVPWNMSEQPASSINCGF
SKTGMPIGLQIVGPRYDDLLVLKLSRAFEQWTGGISAWPEPPAA
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaatgacctcctgaaactgacgatccgcgaactgctcgacctttattcgactaggaag
ctctcgcccttggaatactggctggcggtcgaggatcgcatcgccgccttcgagccgcat
gtgcaggcgctttatctctacgatcccgagagcgcacgggcgcaggccgcagcctccacc
gatcgctggatgaagggcgcgacgaagggcgtgctcgacggcattccggtgacgctgaag
gagttgatcgccaccaagggccagccagtgccgcttggcacggcggccgtcgaactggtg
cctgccgccgaagacgcaccgatcgccgcgcgcatgagagaggacggcgcggtgattttt
gccaagaccacctgcccggactacggcatgctctcctccggcctgtcgagcttccatcac
ctcagccgcaatccttgggatctcacccagaaccctggcggatcgagcgccggcgcgtcg
gccgccggtgccgccggttttggccctctgcatatcggcacggatatcggcggctctgtg
cgcctgccggcgggctggacggggttgttcggttttaagccgagccagggccgtatcccg
gtcgatccgtattatgtcggccgctgcgcggggccgatgacccgcacggtcgaagatgcg
gccttttccatggcgacgctgtcgcgtccggactggcgcgacggcacgtcgctgccgccc
aacgatttcgactggcttaatttcgatatcgacgtgaagggcatgaagatcggcctgatg
ctcgatgccggcatcggccttgcagtcgaggacgaggttcgcgatgcggtcgtggccgcc
gccaagcgctttgaggatgcgggagcgatcattattccggtagaaccggtcatgaaccgc
atcatgctcgacgggctcgacagtttttggcgctcgcggttctggggcgatatcgagaaa
atgccggaagagcgccgggcgctgatcctgccctatatctaccaatgggcggaaggcggc
acttacatttccggcgtcgaagcggtgcgcggcttcaaccagacgatcgaaatgcgcaag
gcctgtggaaggctgttcacgaccgtcgacgcggtgatctcgccgaccaatccgatcgtc
tcttatccggcggagtgggcctcgcccaccaatgatccggctttgcccttcgaacatatc
ggtttcaccgtaccgtggaacatgtcggaacaaccggcctcgtcgatcaattgcggcttt
tcgaaaaccggcatgccgatcggcctgcagatcgtcggcccgcgctatgacgacctgctg
gtgctgaaactctccagggccttcgagcaatggaccgggggcatttcggcctggccggag
ccgccggccgcctga

DBGET integrated database retrieval system