KEGG   Neorhizobium galegae bv. officinalis bv. officinalis HAMBI 1141: RG1141_CH37480Help
Entry
RG1141_CH37480    CDS       T03208                                 

Definition
(GenBank) Pyruvate carboxylase
  KO
K01958  pyruvate carboxylase [EC:6.4.1.1]
Organism
ngl  Neorhizobium galegae bv. officinalis bv. officinalis HAMBI 1141
Pathway
ngl00020  Citrate cycle (TCA cycle)
ngl00620  Pyruvate metabolism
ngl01100  Metabolic pathways
ngl01120  Microbial metabolism in diverse environments
ngl01200  Carbon metabolism
ngl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ngl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RG1141_CH37480
   00620 Pyruvate metabolism
    RG1141_CH37480
Enzymes [BR:ngl01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     RG1141_CH37480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 PYC_OADA Biotin_carb_N Biotin_carb_C HMGL-like Biotin_lipoyl ATP-grasp Biotin_lipoyl_2 Dala_Dala_lig_C HlyD_D23 HlyD_3 ATP-grasp_3 ATPgrasp_Ter Sulf_coat_C
Motif
Other DBs
NCBI-ProteinID: CDN56075
UniProt: A0A068TFB8
Position
complement(3778991..3782452)
Genome map
AA seq 1153 aa AA seqDB search
MSISKILVANRSEIAIRVFRAANELGIKTVAIWAEEDKLSLHRFKADESYQVGRGPHLSK
DMGPIESYLSIPEVIRVAKLSGADAIHPGYGLLSESPEFVEACNEAGIIFIGPRPDTMRQ
LGNKVAARNLAISVGVPVVPATEPLPDDMAVVAKMAEEIGYPVMLKASWGGGGRGMRAIR
DPKDLAKEVVEAKREAMAAFGKDEVYLEKLVERARHVESQVLGDTHGNVVHLFERDCSIQ
RRNQKVVERAPAPYLSEEQRAELAAYSLKIAAATNYVGAGTVEYLMDADTGKFYFIEVNP
RIQVEHTVTEVVTGIDIVKAQIHILEGFAIGTPESGVPAQENIRLHGHALQCRITTEDPE
HNFIPDYGRITAYRSAAGFGIRLDGGTAYSGAVITRYYDPLLVKVTAAGSTPQEAISRMD
RALREFRIRGVATNLTFLEAIIGHPKFRDNTYTTRFIDTTPELFEQVKRQDRATKLLTYL
ADVTVNGHPETKGRPVPSEHSAKPVLPYINGPVPDGTKQLLDTLGPKKFGEWMRNEKRVL
MTDTTMRDGHQSLLATRMRTYDIARVAGVYARALPNLFSLECWGGATFDVSMRFLTEDPW
ERLAMIREDAPNLLLQMLLRGANGVGYKNYPDNVVKYFVAQAARGGIDLFRVFDCLNWVE
NMRVSMDAINEENRLCEAAICYTGDLLNSARPKYDLKYYVSLAEELEKAGAHIIALKDMA
GLLKPAAARVLFKALREATSLPIHFHTHDTSGISAATVLAAVDAGVDAVDAAMDAVSGNT
SQPCLGSIVEALSGSERDPGLDPEWIRRISFYWEAVRGQYAAFESDLKGPASEVYLHEMP
GGQFTNLKEQARSLGLETRWHKVAQTYADVNQMFGDIVKVTPSSKVVGDMALMMVSQDLT
VADVENPAKDIAFPDSVVSMLKGDLGQPPGGWPQALQKKALKGEAPYTAVPGSLLPPADL
AAERKVIEDKLERKIDDFEFASYLMYPKVFTDFALASDTYGPVSVLPTHAYFYGLKDGEE
LFADIERGKTLVVVNQAMSGTDAQGMVTVFFELNGQPRRIKVPDRAHGASGSAVRRKADI
GNAAHLGAPMPGVISRVFATTGQAVKAGDVLLSIEAMKMETALHAEKDGTVAEVLVKAGD
QIDAKDLLIVYGG
NT seq 3462 nt NT seq  +upstreamnt  +downstreamnt
ttgtcgatttcgaagatactggttgccaatcgctcggagatcgccatccgcgtcttccgt
gccgccaacgagcttggcatcaaaaccgttgcgatctgggcggaggaggacaagctctcg
ctgcatcggttcaaggccgacgagagttatcaggtcggtcgcggcccgcatctttccaag
gatatggggccgatcgagagctatctgtccattccggaagtcatccgcgtcgccaagctt
tccggcgccgatgccatccatccgggatacggccttttgtcggaaagcccggaattcgtc
gaggcctgcaacgaggcaggcatcatcttcatcggcccgcggccggatacgatgcgccag
ctcggcaacaaggtcgcggcccgcaatctcgccatctcggtcggcgtgccggtcgtgccg
gcgacagagccgctgccggacgacatggcggtcgttgcgaagatggccgaggaaatcggt
tatccggtgatgctgaaagcctcctggggcggcggcgggcgcggcatgcgcgccatccgc
gatccgaaggatctcgccaaggaggtcgtggaagccaagcgggaggcgatggctgctttc
ggcaaggacgaagtctatctcgaaaagctcgtcgagcgcgcccgccacgtggagagccag
gtgctcggcgatacacatggcaatgtcgtgcacctcttcgagcgcgactgttcgatccag
cgccgcaaccagaaggtcgtcgaacgcgcgcctgcaccctatctttcggaagagcagcgt
gccgagcttgccgcctattcgctgaagatcgcggcggcgaccaattatgtcggtgccggc
acggtcgaatacctgatggatgccgataccggcaagttctacttcatcgaggtgaaccca
cgtattcaggtcgagcatacggtgaccgaggtcgttaccggcatcgatatcgtcaaggcg
cagatccatattctggaaggttttgcgatcggcacgcccgaatccggcgtgccggcccag
gaaaatatccggctgcacggccacgcgctgcaatgccggatcaccaccgaggatccggaa
cacaatttcatcccggattacggccgcattaccgcctaccgttcggcggccggtttcggc
atccgtctcgacggcggcacggcctattccggcgcggtgatcactcgttattacgatccg
ctgctggtcaaggtgacggcggccggctctacgccgcaagaggcgatcagccggatggac
cgggcgctgcgcgagttccgcatccgcggcgtggcgaccaacctgaccttcctcgaagcg
atcatcggccacccgaaattccgcgacaacacctatacgacgcggttcatcgatacgacg
ccggaactgttcgagcaggtgaagcggcaggaccgtgctaccaagctgctcacctatctc
gccgacgtcaccgtcaacggccatccggaaaccaaaggccggccggtgccatccgaacat
agcgccaaaccggtgctgccctatatcaacggcccggttccggatggaaccaaacaactt
ctcgacacgctcggcccgaaaaagttcggcgaatggatgcgcaacgaaaagcgcgtgctg
atgaccgatacgacgatgcgcgacggccatcagtcgctgctcgccacccgcatgcgcacc
tatgacatcgcgcgtgtcgccggcgtctatgcacgggcgctgccgaacctgttctcgctg
gaatgctggggcggcgcgaccttcgacgtttccatgcgtttcctcaccgaagatccgtgg
gaacgcctggcgatgatccgcgaggatgcgccgaacctgctattgcagatgctgctgcgc
ggagcaaacggcgtcggctacaagaactatcccgacaacgtggtgaagtatttcgtcgcc
caggccgccaggggcggcatcgacctcttccgtgtcttcgactgcctcaactgggtcgag
aacatgcgcgtctcgatggatgcgatcaacgaagagaacaggctctgcgaggcggcgatc
tgctacacgggcgatctcttgaactccgcacgtccgaaatacgacctcaaatattatgtc
tcgctggccgaagagctggagaaggcgggcgcccatatcatcgcgctgaaggacatggcc
ggcctcttgaagccggctgcggcgcgggtgctgttcaaggcgctgcgcgaggcgacctcg
ttgccgatccatttccacacccacgacacgtccggcatctcggccgcgaccgtgcttgct
gcggtggacgcgggcgtcgacgcggtcgatgcggcgatggatgcggtgtccggcaatacg
tcgcagccctgcctcggctcgatcgtcgaggccctgtccggttccgagcgcgacccgggc
cttgatccggaatggatccgccgcatctccttctattgggaagcggtgcgcggccagtat
gcggccttcgaaagcgacctcaaggggccggcctcggaagtctatctgcacgagatgccc
ggcggccagttcactaacctcaaggaacaggcccgctcgctcgggcttgaaacccgctgg
cacaaggtcgcccagacctatgcggacgtcaaccagatgttcggcgacatcgtcaaggtg
acgccgtcgtccaaggtggtcggcgacatggcgctgatgatggtctcccaggacctcact
gtcgccgacgtcgaaaacccggcgaaggatatcgctttcccggattcggtcgtatcgatg
ctgaagggcgatctcggccagcctcccggcggctggccgcaggcgctgcagaaaaaggcg
ctgaagggggaggcgccttacacggctgtgcccggttcgcttctgccgcctgctgatctt
gctgcggagcgcaaggtcatcgaagacaagctggaacgcaagatcgacgacttcgagttt
gcctcctacctgatgtatccgaaggtgttcaccgacttcgcgctggcttcggacacttac
gggccggtctcggtactgccgacccatgcctatttctacgggctgaaggacggcgaggaa
ctgttcgccgacatcgagcgaggcaagacgctggttgtcgtcaaccaggcgatgagtggc
acggacgcgcagggcatggtcaccgtgttcttcgaactcaacggccagccgcgccgcatc
aaggtgccggacagggcgcatggggcttccggcagtgcggtgcgccgcaaggcagatatc
ggcaatgccgctcatctcggcgcgccgatgcccggcgtcatttcccgcgtcttcgcgacg
accggccaagccgtgaaagccggcgacgtgctgctctcgatcgaggcgatgaagatggaa
accgcgctgcatgcggaaaaagacggcaccgtggccgaagtcctcgtcaaggccggcgat
cagatcgacgccaaggatctgctgatcgtttatggcggctga

DBGET integrated database retrieval system