KEGG   Neorhizobium galegae bv. officinalis bv. officinalis HAMBI 1141: RG1141_PA05180Help
Entry
RG1141_PA05180    CDS       T03208                                 

Definition
(GenBank) Putative 3-ketoacyl-CoA thiolase (Fatty oxidation complex beta subunit) (Beta-ketothiolase) (Acetyl-CoA acyltransferase) (FadA-like)
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ngl  Neorhizobium galegae bv. officinalis bv. officinalis HAMBI 1141
Pathway
ngl00071  Fatty acid degradation
ngl00072  Synthesis and degradation of ketone bodies
ngl00280  Valine, leucine and isoleucine degradation
ngl00310  Lysine degradation
ngl00362  Benzoate degradation
ngl00380  Tryptophan metabolism
ngl00620  Pyruvate metabolism
ngl00630  Glyoxylate and dicarboxylate metabolism
ngl00640  Propanoate metabolism
ngl00650  Butanoate metabolism
ngl00900  Terpenoid backbone biosynthesis
ngl01100  Metabolic pathways
ngl01110  Biosynthesis of secondary metabolites
ngl01120  Microbial metabolism in diverse environments
ngl01130  Biosynthesis of antibiotics
ngl01200  Carbon metabolism
ngl01212  Fatty acid metabolism
ngl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ngl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RG1141_PA05180
   00630 Glyoxylate and dicarboxylate metabolism
    RG1141_PA05180
   00640 Propanoate metabolism
    RG1141_PA05180
   00650 Butanoate metabolism
    RG1141_PA05180
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RG1141_PA05180
   00072 Synthesis and degradation of ketone bodies
    RG1141_PA05180
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RG1141_PA05180
   00310 Lysine degradation
    RG1141_PA05180
   00380 Tryptophan metabolism
    RG1141_PA05180
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RG1141_PA05180
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RG1141_PA05180
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RG1141_PA05180
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ngl04147]
    RG1141_PA05180
Enzymes [BR:ngl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RG1141_PA05180
Exosome [BR:ngl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RG1141_PA05180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: CDN57353
UniProt: A0A068TG41
Position
pHAMBI1141a:535842..537050
Genome map
AA seq 402 aa AA seqDB search
MTEVFIYDHVRTPRGRGKKDGALHEVPSVRLAAKTLEAIRDRNGLDTSHVDDIIMGCVDP
VMDAGAVIPKAAAFEAGYSTRAPGMQISRFCSSGLDAVNLAAGKIAAGSDDIVIAGGVES
MSRVGMGMSGGSWYMDPSVNFPAFFMPQGVSADLIATKYGFSRDDVDAYAVESQRRAASA
WDAGYFKNSVIPVKDQNGLTILDRDEHMRPTTDMQSLASLNPSFQMPGEMGGFEAVGIQA
HPEIERINYVHHAGNSSGIVDGAAAVLVGSKAGGEAMNLKPRARIRHFANIGSDPALMLT
GPVDVTEKLLARSGMKISDIDLFELNEAFAAVVLRYMQAFEIGHDRINVNGGAIAMGHPL
GATGAMILGTVLDELERRDLNTALVTLCIGAGMGTATIIERV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaagtcttcatttacgaccacgtccgcacgccgcgcggtcgcggcaagaaggat
ggggcgctgcacgaggtgccgtccgtgcgcctcgcggccaagacgctggaagcgatccgc
gaccgcaacggcctcgacacgtctcatgtcgacgacatcatcatgggctgcgtcgatccg
gtcatggatgccggcgccgtcatccccaaggccgctgccttcgaggccggatattccacc
agggcgcccggcatgcagatttcccgtttctgctcctcgggcctcgatgcggtcaatctt
gcggccggcaaaatcgcggccggttccgacgacatcgtcattgccggcggcgtcgagagc
atgtcgcgggtcggcatgggcatgtccggcggctcctggtacatggacccgtcggtcaat
ttcccggctttcttcatgccgcagggcgtctcggccgacctgatcgccacgaaatacggt
ttttcccgcgacgacgtcgacgcctatgccgtcgagagccagaggcgcgcggccagcgcc
tgggacgccggctacttcaagaactcggtcattccagtcaaggaccagaacggcctgacc
atcctcgaccgcgacgagcacatgcggccgaccaccgatatgcagtcgctggcctcgctc
aacccgtcgtttcagatgccgggcgagatgggcggtttcgaagcggtcggcatccaggcc
cacccggaaatcgagcggatcaattacgtccaccacgccggcaattcgtcggggatcgtc
gacggcgccgcggccgtgctggtcggctcgaaagccggcggcgaagccatgaacctgaaa
ccccgagcccgcatccgccacttcgccaatatcggctccgatccggcgctgatgctgacc
ggcccggtcgacgtcaccgaaaagctgctggctcgctcgggcatgaagatctccgatatc
gacctcttcgagctcaacgaagccttcgccgccgtggtgctgcgctacatgcaggccttc
gagatcggccacgacaggatcaacgtcaacggcggcgccatcgccatgggccacccgctc
ggcgccaccggcgcgatgatcctgggcaccgtcctggacgaattggaacgccgcgatctc
aacaccgcgctggtcacgctctgcatcggcgccggcatgggcaccgcgacgattatcgag
agagtttga

DBGET integrated database retrieval system